HOG Organism Gene ID Name Annotation
aHOG3983 hbo HBOR31630 Hbor_31630 subtilisin-like serine protease
aHOG3983 hla HLAC1627 Hlac_1627 putative signal transduction protein with CBS domains
MUSCLE (3.6) multiple sequence alignment


31630|gene|hbo      MTMSNARSITRVLALVFAVLTVTGTVAPAVGATMTAEHGAIADEIGSVSGESNGGALSAM
1627|gene|hla       ------MNIVDIAVPEYVEVDVSERLA----------------KVRSIFEREN-------
                           .*. : .  :. : *:  :*                :: *:   .*       

31630|gene|hbo      RASATNTDDSSSTPGDTNGEATPEGTSDSTTAPEGTNDNSSASDGNGNSAVPDGTDENTT
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      TPDGPNGNATTPDGGNDTVTTPDGTDDDTTTPDGTNDNSTTPDGTDNNATTPDGTNDNST
1627|gene|hla       ----PKGIIVTEDG----------------------------------------------
                        *:*  .* **                                              

31630|gene|hbo      TPDGTDSNATTPDGTNDNATTPGTGTATPSENSTDGTNSTSAGKRTNETQTNATAANRTV
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      VESWAANASSSVEVIVRVEEFEVPTVSTMSQETVVEKLKAHAETSQQPVIDYAESTDGVT
1627|gene|hla       --------------------------------------------------EYA-------
                                                                      :**       

31630|gene|hbo      VLNRYWLTNALLLRVDTAKTNASKLVGQPGVTGIHKNFEVRALSTAASRNNTTASGATTA
1627|gene|hla       -----------------------------GVVGEKQLMRSRM-------EDDTKVSAVMK
                                                 **.* :: :  *        :: *  .*.  

31630|gene|hbo      STPATTEVTYGLDQLNVPAVWAKHGTKGAGAKVAVLDTGIDVGHPDLELYTEDPGNDTYP
1627|gene|hla       SAPSVD----------------RHEDLRETARLLV-------------------------
                    *:*:.                 .*      *.: *                         

31630|gene|hbo      GGWAEFDTNGDRVTGSTPHATSGHGTHVSGTVAGGTASGKAIGVAP--DADMMHGLVLPD
1627|gene|hla       --------EGD------------------------------VKIAPVYEGEKLYGIV---
                            :**                              : :**  :.: ::*:*   

31630|gene|hbo      GTGSFAQIIGGMQWAVEEDADVISMSLGADGFYSTLVTPIRNAEDAGTVVVAAAGNHGPE
1627|gene|hla       --------------TVDQILEAVLDSL---------------------------------
                                  :*::  :.:  **                                 

31630|gene|hbo      TAPSPGSIYDSLTVGASGPNRDIAPFSSGDVVRTERDWGDAAPSDWPDEYVMPDIAAPGV
1627|gene|hla       ---------DAITVG---------QIATEDVI--------------------------GI
                             *::***          ::: **:                          *:

31630|gene|hbo      DTYSTLPGGKYGEKSGTSMATPHVSGVVALMVSASGGDASPEEIRTALRKSATKPDDAPA
1627|gene|hla       NEKDTV---------GSAINRLRENGISRL----------------------------PA
                    :  .*:         *:::   . .*:  *                            **

31630|gene|hbo      KKDIRYGNGIIDALDATTAVAAEQGISGSISNTGGEPLSGASVRLDSGAATATDANGDYL
1627|gene|hla       LDEDGHLVGVVTTNDIVEFVVRDQERQGS-------------------------------
                     .:  :  *:: : * .  *. :*  .**                               

31630|gene|hbo      IRTLSGTYNTTVSEFGYASSTATVTVTGGSMTTHDVSLKPALAAEITSPQNGKVKAGTAA
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      SVTYRTAHAETLTVSRTGDTSGNATLYINGKERAFGESVSINASDDTRVQVRVETEAGST
1627|gene|hla       -----------------GDRAGDI------------------------------------
                                     ** :*:                                     

31630|gene|hbo      GTLALKHTISGLGETTTFTTGPTEIVSDPTYVTVVDSTGSEYAEQIRAAIEANVPREYFV
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      SIISPREAMANTDEYDVFVVHQVNSNVNLQSFVEATSGPETGVVYLDQWGAASNGITALS
1627|gene|hla       ------DRMLDIPVYDIM------------------------------------------
                          : * :   **::                                          

31630|gene|hbo      DATQNPVVTGQTTETDQPTYEVVANHSIFDGIAARGESITIHNQSRGDIAWFERFRGTTL
1627|gene|hla       ---SSPVVTATADETAEAVVERMFDNNV-SGL----------------------------
                       ..****. : ** :.. * : ::.: .*:                            

31630|gene|hbo      AVASDNGADIGTGVAIDESKQTVLLSSLGRTSTVQNRYVNDDADALLGNAVTYVNSLPPA
1627|gene|hla       -VVTPKGADTIAGMVTK-------------------------------------------
                     *.: :***  :*:. .                                           

31630|gene|hbo      WLESSQPKHVTPGESFAVDVAADDLRRLNVTLADSMMLSESDLTLSINGTEREFGESYDI
1627|gene|hla       ---------------------TDVLRALTFTEQDSMDVQITNVAL-LDTTSREH------
                                         :* ** *..*  *** :. ::::* :: *.**.      

31630|gene|hbo      NDSADNVTVAVNTSTGIVGTVGLSIAAESSNDTVELLSGETAVYEKPLVVPEDVKTIQRA
1627|gene|hla       --------------------------------IVESIEQVASKYADMHVIHAHVR-----
                                                     ** :.  :: * .  *:   *.     

31630|gene|hbo      VNLAPAGTTVEVATGTYTNRVTITTPGITLTAHDEERPTIDTRVWGFYDPVVHVDAPNVT
1627|gene|hla       -----------------------------LHAHKE-------KLRG--TPLIQCQ-----
                                                 * **.*       .:.*   *::: :     

31630|gene|hbo      VEHLNVVADGIAPDGIAVERSNATIRHVSVSGTSHGVLIGGAGSTADDAVVHDVNISDGA
1627|gene|hla       ------------------------IRLRTNEGQ-----VGGSGE----------------
                                            **  : .*      :**:*.                

31630|gene|hbo      DLLAIGVTVGEADNAHVYNATISGQDSGADVYTSSGTVIENSTITDSGTGLTTFETDNVR
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      FVGNEIHDMDESATNTVGIQLEAFVTSATIEDNEIWNLSEGIYVEGTNTGGEIVGNDIDT
1627|gene|hla       ------------------------------------------------------GYGAEH
                                                                          * . : 

31630|gene|hbo      EYGVWVERGDAPAIEIKHNDLAATNVSVGNGLDGSLRATMNYHGERSGNESFVSGDVTYE
1627|gene|hla       AFHVALDKLERNVLEIK-------------------------------------------
                     : * ::. :  .:***                                           

31630|gene|hbo      PFLTAPPEDVDTDTPQQIGVDLTLEAGNVYGVSVPGTTRQTVSDLFDDEFRGVVYGFDAS
1627|gene|hla       ------------------------------GVNA------------DEEYRG--------
                                                  **..            *:*:**        

31630|gene|hbo      DQSWTQLSGDDEIAALQGLAVVAESDGRMTVTHFVGSNQPSAPGQRTLTEGWNFVGSPEY
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      GDLESGLNVETVDPGLAMAPFDAPSSQPGSSSGFDGVYRFDGTSTPPDVSAYEGYFVFVE
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      AESTLPSYVVPNPSATELYEGIGLYPINASANASATTNGTVSVDAVLSRTDEMDRAAARL
1627|gene|hla       --------------------------------------------QLLRKLGEL-------
                                                                 :* . .*:       

31630|gene|hbo      ALSQLIYRDLNSAVRGEKASQTTLNETADAIIADAPDEHEALVANATADALERIRGNGTR
1627|gene|hla       ------------------------------------------------------------
                                                                                

31630|gene|hbo      TGAAGLNEQADSQASNATAPSITG
1627|gene|hla       ------------------------