HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0397COG1354arCOG02610Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0397 nrc1 VNG0340 vng340 no entry
cHOG0397 hmu HMUK3001 Hmuk_3001 chromosome segregation and condensation protein ScpA
cHOG0397 hma RRNAC1638 hypothetical protein
cHOG0397 hwa HQ1263A smc operon protein
cHOG0397 hla HLAC0528 Hlac_528 chromosome segregation and condensation protein ScpA
cHOG0397 hbo HBOR25300 Hbor_25300 condensin subunit ScpA
cHOG0397 hut HUTA2737 Huta_2737 chromosome segregation and condensation protein ScpA
cHOG0397 hvo HVO_0690 HVO_0690 segregation and condensation protein A putative
cHOG0397 nph NP1214A smc operon protein
cHOG0397 hhi 2181 scpA chromosome segregation and condensation protein ScpA
MUSCLE (3.6) multiple sequence alignment


2737|gene|hut       ------------------------------------------------------------
340|chp|nrc1        ------------------------------------------------------------
1214|gene|nph       ------------------------------------------MTDDRRAATDGGAADEIP
528|gene|hla        ------------------------------------------------MTEPPESAGGVP
11638|hp|hma        MRRFRLMTSEEPTEQRDGDSSEQSSGEGEARPEEAPRGSERGANVARERSDPRDDADDIP
2181|gene|hhi       ----------------------------------------------MTDEGVESQADDIP
1263|gene|hwa       ------------------------------------------------------------
25300|gene|hbo      ------------------------------------------------------------
                                                                                

2737|gene|hut       -----MTEEELMSENKQVDTEKGEQTRPDGGTDVMTGSGGFTQPSLDADGEVEPVEVLVG
340|chp|nrc1        ------------------------MTDRDAVPVASPGHEGR---SDADGDAVEPVAVLVR
1214|gene|nph       LDITGH-------GDTREATQLGDGDERDEPLSEFDIEE-----PGGDDDTVEPVELLVQ
528|gene|hla        NLDLTSERDGGSRDGSLPETPGTDEPAANETDAKGTGEAGE---GSGEDDEVEPVELLVQ
11638|hp|hma        LNITGHEDREPPGGSDDAAALLGDSPDPDDETTAQDSPESDRTTDEDEDEDVEPVEVLVQ
2181|gene|hhi       LNITGHEDRDPPGESGDAAALLGESPDSDDPSPEQDGPESDSD-DDSDDEDVEPVEVLVQ
1263|gene|hwa       -------------MTDMGSSPHSEEPEAGVIDDIRGYADQN---DDTSSDAIEPVELLVQ
25300|gene|hbo      ---------------MTEGAPVREAVMPDSVDV-----------PEDDDDEVEPVELLVQ
                                                .                   .  :*** :** 

2737|gene|hut       LAEDDEIDPWDIDVVRVTDKFLERLDEADLRTSGRALFYASVLLRLKSDALLEDDD-PAE
340|chp|nrc1        LAERGEIEPWDIDIVAVTDKFLAALDEADLRTSGRALFYASVLLRMKSEAMLDDDD-DED
1214|gene|nph       LAEEGEIDPWDIDVVTVTDKFLDRLDEADLRTGGRALFYASVLLRMKSDELWNDDE-PDD
528|gene|hla        LAEEGEIEPWDIDIVQVTDAFLEKLDETDLRTTGRALFYASVLLRMKSDGMLADDDGDDE
11638|hp|hma        LADDGEIDPWDIDVVRVTDKFLQRIDDADLRTSGRALFYASVLIRMKSDAMLGEGE-TEE
2181|gene|hhi       LADDGEIDPWDIDVVRVTDKFLQRIDDADLRTSGRALFYASVLIRMKSDAMLGEGD-DEE
1263|gene|hwa       LAEEGRIDPWEVDIVDATDAFLNRLDKTDLRTSGRALFYAAVLLRMKSEALIEPDE-PAD
25300|gene|hbo      LAEDGEIDPWDIDVVEVTDAFLERLDTADLRTSGRALFYASVLLRMKSDALLEPDA-AEE
                    **: . *:**::*:* .** **  :* :**** *******:**:*:**: :   .    :

2737|gene|hut       ----EPAVDELADPFA-----------------AGDLSGGDSDPFDALEDEMDRRLDRKR
340|chp|nrc1        ADDGDDERAPWEPP-------------------GGDDAQPASDPVASLEAEMERRLDRKQ
1214|gene|nph       ----EPEAAPWEAPP------------------GEEPPAGG-DPFAELEREIDRRIERKD
528|gene|hla        ----EPEPEPWEVAMEGG---------------APDPADGDFDPIDELEAEMDRRLDRKN
11638|hp|hma        ----EP-AEPWEQAM------------------HEDAPIEDPDPFAALESEMDRRLERRR
2181|gene|hhi       ----DP-VEPWEQAM------------------HEDAPIEDPDPFAALESEMDRRLERRR
1263|gene|hwa       ----ASESEPWEVALEAGTRPIDEFENANMTDGSNSTPHSDSDPIDALEDEMDRRLERKK
25300|gene|hbo      ----EPELEPWEAALEGGGEMAD----------GEADGAPGFDPVDALEAEMDRRLERKH
                                 .                            **.  ** *::**::*. 

2737|gene|hut       ARGTPDTLEDLVRELREAERSADWKESREYDTSDSPRGFRRGTQELDYRMDDDMREDAEP
340|chp|nrc1        ARGSPQTLDELVRELREAERGSWWKESREYDTSDSPQGFRRGVNEMEYRSGDAGRMADEP
1214|gene|nph       ARGTPETLDELVRDLRERERETWWKESRSYDTSESPSGYSRGTQTLDYHDSDEFRMDEEP
528|gene|hla        TRGSPETLDELVRELREAERGSWWKDSREYDTSESPHGHARGTQTLDYHTGDEFRRDGEP
11638|hp|hma        ARGMPQTLDELVRDLRDAERESWWKESREYDTGDSPSGYDRGTQELDYRGADDMRLDEEP
2181|gene|hhi       ARGMPQTLDELVRDLRDAERESWWKESREYDTSDSPSGYDRGTQELDYRGADDMRLDEEP
1263|gene|hwa       ARGSPETLDELVRELREAERESWWKRHREYDTSDSPSGYQRGTQTLDYHTADDFRDAAEP
25300|gene|hbo      ARGNPETLDELVRELREAERESWWKRRREYDTSDSPRGYRRGTQTLDYRSADDFRDNDEP
                    :** *:**::***:**: ** : **  *.***.:** *. **.: ::*.  *  *   **

2737|gene|hut       TVEDVTGTAHGENVEELVESVATKIETQFDAGRDAVLFAEVDGAAGSRIESFLGLLFLSN
340|chp|nrc1        TTAETLGNAHGEDIEATITDVRGALAAQYEAGRDEVLYAEIAAAGPSRVETFLAVLFLAH
1214|gene|nph       TAADVTERTHDEHMEDIINDVYVSLQQHYDRGREEVLFAEVRTAGGSTVDSYLGALFLAH
528|gene|hla        TAGEATDRTHDEDIEEVIVGIDNALRTQFDRGRTEVLFAEIETAGGRPFMTYLALLFMAH
11638|hp|hma        SAADVTGTAHAENIDDIIADVHDAVREQYDQGREEVLYREVDTAGGSRVETFLGLLFLAH
2181|gene|hhi       SAADVTGTAHAENIDDIIADVHDAVREQYDQGREEVLYREVDTAGGTRVETFLGLLFLAH
1263|gene|hwa       TAADVTDTAHGEDIETEIKAVYAALTDQYEKGRIEVLFTEVADVASTPVSTYLAVLFLSH
25300|gene|hbo      TAADVTGTTHTEDIESSIETVESELRSQYENGRDEVLYAEIRSVAATPVTTYLSLLFLSH
                    :. :.   :* * ::  :  :   :  ::: **  **: *:  ..   . ::*. **:::

2737|gene|hut       QGRIVLEQDEYFGDLWIQPPES--------------------------TAAE-
340|chp|nrc1        RGAVTLAQDELFGDLWVQATEEF-----------------PAQAA---TVPPA
1214|gene|nph       RGQVRLRQDDLFGDLWIQDPTSA-----------------AAEGQ---AAADD
528|gene|hla        RGSVRLQQDDLFGDLWVKDPSAM-----------------AGESE---AIAD-
11638|hp|hma        RGQVRLQQDDLFGDLWIQDPSAA-----------------TGSDE---AIAD-
2181|gene|hhi       RGQVRLQQDDLFGDLWIQDPSAA-----------------TGSDE---AVAD-
1263|gene|hwa       RDKVMLEQTDLFGDLWIQTPKT------------------SAESSPTAVADDD
25300|gene|hbo      RGVVRLQQDDLFGDLWVQNPEAVELDEGGDSDDGDSEAADTGEDDAVEAIAD-
                    .. : * * : *****:: .                            .