HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0396COG0522KOG4655 KOG3301arCOG04239Ribosomal protein S4 and related proteins30S ribosomal protein S4P

HOG Organism Gene ID Name Annotation
cHOG0396 nrc1 VNG1133 rps4p 30S ribosomal protein S4P
cHOG0396 hmu HMUK2590 Hmuk_2590 ribosomal protein S4
cHOG0396 hma RRNAC0059 rps4p 30S ribosomal protein S4
cHOG0396 hwa HQ2943A rps4p 30S ribosomal protein S4
cHOG0396 hla HLAC1817 Hlac_1817 ribosomal protein S4
cHOG0396 hbo HBOR12560 Hbor_12560 SSU ribosomal protein S4P
cHOG0396 hut HUTA2523 Huta_2523 ribosomal protein S4
cHOG0396 hvo HVO_2783 HVO_2783 rpsD ribosomal protein S4
cHOG0396 nph NP2830A rps4p 30S ribosomal protein S4
cHOG0396 hhi 819 rps4p 30S ribosomal protein S4
MUSCLE (3.6) multiple sequence alignment


1133|gene|nrc1      MALPGENTKFYETPNHPYQGERIAEESDLLSRYGLKNKEELWRAQSELRDYRREARRLLG
1817|gene|hla       MST-GKNTKGYETPNHPYQGERIAEESDLLSRYGLKNKEEFWRAQSELRSMRREARRLLG
2943|gene|hwa       MST-GSNTKRYETPNHPYQGERIAQEGDLLGRYGLKNKEELWRTQSELREYRREARRLIG
12560|gene|hbo      MAT-GKNTKFYETPNHPFQGERIAQEADLLGRYGLKNKEELWRAQSELRNYRREARRLIG
10059|gene|hma      MAL-GSNTKFYETPNHPFQGERIADEANLIGRYGLKNKEELWRAQSELRGYRREARKLLG
819|gene|hhi        MAL-GSNTKFYETPNHPFQGERIADEANLIGRYGLKNKEELWRAQSELRGYRREARKLLG
2523|gene|hut       MAL-GSNTKFYETPNHPFQGERIADEQSLIGQYGLKNKEELWRAQSELRSYRREARKLLG
2830|gene|nph       MAL-GSNTKFYETPNHPFQGERIAEEGDLLSRYGLVNKEELWRAQSELRDYRREARRLIG
                    *:  *.*** *******:******:* .*:..*** ****:**:*****  *****.*:*

1133|gene|nrc1      QT------GTVSGEEFVARLQRIGILSEEERLDDVLSLEVTDVLERRLQTVVYREGLANT
1817|gene|hla       EAQGDVDVAQEAGAEFVARLRRIGILGDNDDISAVLSLDVTDLLERRLQTVAYRQGFASS
2943|gene|hwa       EAQGDVSVAEALGEEFLDRLRRYGILSADDDISKVLGLDVSDILERRLQTIVYRQGLAST
12560|gene|hbo      EAQGDMEQAEELGVEFLDRLRRYGILSEDDNISEVLGLDVTDILERRLQTVAYRKGLGHT
10059|gene|hma      SA----GEHETESEEFLARLKRYGILNEQDQLDDVLSLDVTDVLERRLQTVVYRKGYANT
819|gene|hhi        SA----GEHETESEEFLARLKRYGILNEQDQLDDVLSLDVTDVLERRLQTVVYRKGYANT
2523|gene|hut       G-----GGTAEESEEFIARLKRYGILDEGDALDDVLSLDVTDVLERRLQTVAYRKGLANT
2830|gene|nph       EAQGDTVAAAEAGSEFLARLKRIGVLDDEDSLDDILSLDVTDILERRLQTVAYRKGLGNT
                                . **: **.* *:*.  : :. :*.*:*:*:*******:.**:* . :

1133|gene|nrc1      MGQARQFVSHGHVTVDGSRVTEPSYTVPVSEENTLAFDETSDLTDELHPARAGAQE
1817|gene|hla       TQQARQFIVHGHITVDGARVTRPSVKVDVDDEGAIAFDENSPLADDLHPERAESQE
2943|gene|hwa       PKQARQFIVHEHITVNGARVTRPSKMVEETEANAIAFDENSPLADSLHPARAEGQE
12560|gene|hbo      PDQSRQFIVHGHVVVDGARVTRPSKMVEVSEEGLVEFDEGSPLSDELHPERAEGQE
10059|gene|hma      PEQARQFIVHGHIVLDDARVTRPGMTVETAVESSVGFDEHSSLSDELHPERAEAQE
819|gene|hhi        PEQARQFIVHGHIVLDDARVTRPGMTVETAVESSVGFDEHSSLSDELHPERAEAQE
2523|gene|hut       AQQARQFISHGHVTVDGERVSIPSKTVAVEEEGAIEFDENSPLADDLHPERAEER-
2830|gene|nph       PQQARQFIAHGHVTVNGARVSAPSYKVDVAEEGEIEFDETSPLADDLHPERAEGQ-
                      *:***: * *:.::. **: *.  *     . : *** * *:*.*** **  .