HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0393COG0294arCOG01978Dihydropteroate synthase and related enzymesdolichol-P-glucose transferase

HOG Organism Gene ID Name Annotation
cHOG0393 nrc1 VNG1344 dhpS dolichol-P-glucose transferase
cHOG0393 hmu HMUK2771 Hmuk_2771 dihydropteroate synthase( EC:2.5.1.15 )
cHOG0393 hma RRNAC0246 folP3 dihydropteroate synthase
cHOG0393 hwa HQ2465A folP dihydropteroate synthase
cHOG0393 hla HLAC1387 Hlac_1387 dihydropteroate synthase
cHOG0393 hbo HBOR14350 Hbor_14350 Dihydropteroate synthase( EC:2.5.1.15 )
cHOG0393 hut HUTA2646 Huta_2646 Dihydropteroate synthase
cHOG0393 hvo HVO_2908 HVO_2908 dchpS dihydropteroate synthase
cHOG0393 nph NP3770A folP_2 dihydropteroate synthase 2
cHOG0393 hhi 990 folP2 dihydropteroate synthase
MUSCLE (3.6) multiple sequence alignment


10246|gene|hma      ---------MRTVEIDGLPVGDGHPTRVMSVLNMSSNSGYKPSVYLDPAEAAEAIEENLV
990|gene|hhi        ---------MRTVEIDGLPVGDGHPTRVMSVLNMSSNSGYKPSVYLDPAEAADAIEENLV
3770|gene|nph       ---------MRTVDAAGLQIGDDHPPRIMGVLNVSEESPYDPSVFDEPDEAARYVDEDLI
1387|gene|hla       ---------MRNVDAAGLEIGDDHPPRIMGVLNVSAESPYDPSVYDDPGEAAEYVDEELI
2465|gene|hwa       ---------MRSVDAAGLSIGDESPPRIMGVLNISKESPYDPSVFDEPDAAATYVDSELI
14350|gene|hbo      ---------MRTVDAAGLEIGDDHPPRIMGVLNVSKESPYEPSVFNDAGEAAKYVDTALI
2908|gene|hvo       ---------MRTVDAAGLEIGDDHPPRIMGVLNVSKESPYKPSVFNDPSEAAEYVDRELI
1344|gene|nrc1      MSVPPSSRDMRTVDAAGLPIGDDYPPRIMGVLNVSKESPYDPSVYDDPEAAAAYVDSELI
2646|gene|hut       ---------MHNVDAAGLGIGDDHPPRIMGVLNISQESPYDPSVFADPDEAAAYVE-DMI
                             *..*:  ** :**  *.*:*.***:* :* *.***: :.  **  ::  ::

10246|gene|hma      PAGADIIDVGLQSANPKYESKPVEMEKDRLEEVAPLVDELDADVPLSLETRYAEVAEEAI
990|gene|hhi        PAGADIIDVGLQSANPKYESKPVEMEKDRLEEVAPLVDELDADVPLSLETRYAEVAEEAI
3770|gene|nph       GEGADIVDVGLESANKKFEVLSADQELDRLDTAVETLRSTSGDAVWSIETRYHEVAEAAL
1387|gene|hla       GEGADIVDVGLESANKDLDVLSAEQELDRLDTAIETLESTSGDAVWSIETRYHEVADEAL
2465|gene|hwa       DEGADIVDIGLESANKRFDVLSAEQELTRLETAIEAIQSVSGDAVFSIETRYHEVADTAL
14350|gene|hbo      DEGADIVDVGLESANKRFEVLSAEEELDRLDTAVEVLESVSGDAVFSIETRYHEVADEAL
2908|gene|hvo       DEGADIVDIGLESANKRLDVLSAEDELDRLDTALSVLDSVSGDAVFSIETRYHEVAEAAL
1344|gene|nrc1      GEGADIVDVGLESANKDLDVLSADQERERLQTAIDTIERVEGEAVFSIETRYSEVADEAL
2646|gene|hut       DAGADIVDVGLESANKRLDVLSAEEERERLDTAIETIDAVDGDAVFSIETRYSEVADEAL
                      ****:*:**:***   :  ..: *  **: .   :   ..:.  *:**** ***: *:

10246|gene|hma      GHGFDVINDVCGFADPEMKGVVEDHDMPVVKMASPPDLASPGAL----------------
990|gene|hhi        GHGFDLINDVCGFADPEMKGVVEDHDMPVVKMASPPDLARPGAL----------------
3770|gene|nph       DAGFDMVNDICGFADPEMTTVCAEYDVAVSKMASPPDLERPGAI----------------
1387|gene|hla       ARGFDMVNDICGFADPEMPRVCREHDAAVSKMASPPDLERPGAI----------------
2465|gene|hwa       SRGFDMVNDICGFADPKMPEVCSEYDVAVGKMASPPDLTRPGAI----------------
14350|gene|hbo      SRGFDMVNDICGFADPEMPTVCTDHDAAVAKMASPPDLERPGAI----------------
2908|gene|hvo       DGGFDMVNDICGFADPVMPRVCEEFDAAVAKMASPPDLTRPGAI----------------
1344|gene|nrc1      AAGFDMVNDICGFADPEMPAVCEAHDVAVAKMASPPDLERPGAI----------------
2646|gene|hut       SRGFDMVNDVCGFADPEMPAVCESHDAAVVKMASPPDLERPGAVGETDWTERCDAEWAAD
                      ***::**:****** *  *   .* .* ********  ***:                

10246|gene|hma      -KTIDDIFEALQRDGFTDKTIIDPAFGGWYDGKEFEDNWEMFRRLREFRAFDRPMLTATN
990|gene|hhi        -KSIDDIFEALQRDGFTDKTIIDPAFGGWYDGKEFEDNWEMFRRLREFRAFDRPMLTATN
3770|gene|nph       -DDVDDIYAALEQNGFTEKTILDPAFGGWSETKTIEDDRETFRRLREFRAYGRPLLVSIN
1387|gene|hla       -EDVDEIYEALSMNGLTDKTILDPAFGGWSKAKTHADDRETFHRLREFRGYGRPLLVSIN
2465|gene|hwa       -ENVDDIYEALAQNGFTEKTIIDPAFGGWSEEKTLADDRETFQRLREFRGLGRPILVSIN
14350|gene|hbo      -EEVDDIYDALAQNGFTDKTIVDPAFGGWSEAKTLEHDRETLRRLREFRGYGRPILVSIN
2908|gene|hvo       -EEVDDIYDALELNGFTDKTILDPAFGGWSEAKTLEHDRETFDRLREFRGYGYPILVSIN
1344|gene|nrc1      -ESVDDIYDALSLHGFTDKTIVDPAFGGWSTEKTLADDRETFDRLREFRGYGYPMLVSIN
2646|gene|hut       ADYVDQVYEALKQGGFTEKTIVDPAFGGWSESQTLEDDRETFHRLSDFRELGRPMLVSIN
                     . :*::: **   *:*:***:*******   :    :.* : ** :**  . *:*.: *

10246|gene|hma      REDFLGDLADQPETENQLAVSLAAATMEAERGAHIIRTHDTRETHDVVKVADALGDERTT
990|gene|hhi        REDFLGDLADQPETENQLAVSLAAATMEVERGAHIIRTHDTRETHDVVKVADALGDERTT
3770|gene|nph       RKNFLRDIAGR-DTEAALPVSLAATSMAVERGAHVIRTHDVAETRDAALVGHEFTPER--
1387|gene|hla       RKSFLKTIAGR-STEEALPVSLAATSMAVERGAHVIRTHDVAETRDAALVGAEFARDR--
2465|gene|hwa       RKNFLRSIADR-STEEALSVSLAATSLAVERGAHVIRTHDVAETRDAALIGDAFTPDRPS
14350|gene|hbo      RKNFLREVAGR-DTEEALPVSLAATSMAVERGAHVIRTHDVAETRDAALIGKEFARHR--
2908|gene|hvo       RKNFLRDVAGR-STEEALPVSLAATSMAVERGAHVVRTHDVKETRDAALIGHEFERRR--
1344|gene|nrc1      RKNFLREIAGR-DTAGALPVSLAATAMAVERGAHVVRTHDVAETRDAALIGHEFTPDR--
2646|gene|hut       RKNFLREFVGR-STEEALPVSLAATALAVERGADVIRAHDVAETRDAAIIGHEL------
                    *:.**  .... .*   *.*****::: .**** ::*:**. **.*.. :.  :      

10246|gene|hma      RPETDSGPT---VAELTDVTLREVARHQALGETVAGG----TDDGATLTFLLGDVTDDAR
990|gene|hhi        RAETEPGPT---VAELTDVTLREVARHQALGETVAGG----TDDGATLTFLLGDLTDDAR
3770|gene|nph       ----ANGSG---FEALDVTTDRELARH--LGRTVDDA----PEPSVLPHAVAFGLPSGPA
1387|gene|hla       -VRSDDGPSDIAVEELDVTTVREAERH--LDRLDADQ--SVAGDAAVRTYELRGLTDEAV
2465|gene|hwa       HHLTTDDDSQVTAEELDVTTSAEAGRH--LDRLGISSMNDITDNSIIHTLEIDGLSRSAV
14350|gene|hbo      ----TRKSGDVTVEELDVTTPREVERH--LDRLGVESPASIATEAVVRVFELDGLSDEDV
2908|gene|hvo       ----VRDPGDVSVEELDVTTTGEAARH--LDRVGANR--DLAAESVMRVFELEGLGADDR
1344|gene|nrc1      ----THTSH---IEQLDVTTLPAAMRH--ADRLGADG----AADAVARAYEVTGLSADDR
2646|gene|hut       -----------------------------------------------------GVGPEAF
                                                                         .:     

10246|gene|hma      ASLRA---VAEVTDVVVVEKDGGS--------------------LYVGGSAAALKVVTDS
990|gene|hhi        ASLRA---VAEVTDVVVVEKDSGS--------------------LYVGGAAVALKVVADS
3770|gene|nph       AYLGE---QARTVGLETYHGDRL---------------------VVVGTADGFKTLRTAI
1387|gene|hla       GALRAATAEPGVGAAFALAGSDAAETAVPPSATDGGAPTNGESGLLVGTVAALSAVRSAV
2465|gene|hwa       TELSTVTAKSDSAVVTAVESESGREANLDSDSQSSGI-------FLAGTPASL-DAIATT
14350|gene|hbo      RTLAA---AAGDAGATVARGTTADGAD------SHCV-------LLLGTARALCETVAFS
2908|gene|hvo       EALEA---AAGDAGAVLAAGDTGA--------------------LLVGTPAALARLSTLV
1344|gene|nrc1      DALAATGVAVSGTDPTLVAGTAGA--------------------LREAGAG-----LAAA
2646|gene|hut       E-----------------------------------------------------------
                                                                                

10246|gene|hma      LAEDGHRELAGELRTSLSRRV---
990|gene|hhi        LAEDGHRELAGELRASLSRRV---
3770|gene|nph       EDDADAPQRASEAITELSAQFGGV
1387|gene|hla       SGVSDALDAALESIDDGSK-----
2465|gene|hwa       VDDSVLTEILTSITRQISR-----
14350|gene|hbo      EGESESLATALHSVENGVL-----
2908|gene|hvo       TDASDALEAALETVERATR-----
1344|gene|nrc1      TDGDSVLATLAEIFRTAGE-----
2646|gene|hut       ------------------------