HOG Organism Gene ID Name Annotation
aHOG3911 hla HLAC3455 Hlac_3455 metallophosphoesterase
aHOG3911 nrc1 VNG0417 ppe predicted phosphoesterase
MUSCLE (3.6) multiple sequence alignment


3455|gene|hla      MLVLGDAHAADRSKRRALHAAYDAADAEYALQLGDLMHYDLPIPTYFVAGNNEDFDVIDA
417|hp|nrc1        MLVLGDAHATTPGRRRALFAAYRAANESVAVQAGDLMYYDLPVQTYFIGGNNEDFDAIDA
                   *********:  ..****.*** **: . *:* ****:****: ***:.*******.***

3455|gene|hla      LRSGD-SPDGVRNANLLASTVVERDGLRIAGLSGNYAPTQYEKDRSELASERRRHFVEAD
417|hp|nrc1        LRNGRVESDDVANATLLNSTAATVDGRRVAGLTGNYAPTQFDKPRAVLRGDRRRHFVRSD
                   **.*  ..*.* **.** **..  ** *:***:*******::* *: * .:****** :*

3455|gene|hla      VERAKVLEDVDVFLVNESPHGVDVTEDYQVGCRYVDAILRELEPDLCLLGHHHEHVEGVY
417|hp|nrc1        VEAVMDLDDIDIFVAHEAPNGLPVEEDYDVGCQHIDDILDALQPSLCLVGHHHQHAECDY
                   ** .  *:*:*:*:.:*:*:*: * ***:***.::* **  *:*.***:****:*.*  *

3455|gene|hla      GDTRVVSLAPAWDSYYTLDPRTLELERYATPSE
417|hp|nrc1        GDTHVVGLEPAWESYYVVDPDTLAVTRHDTPPA
                   ***.**.* ***:***.:** ** : *: **.