HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0039arCOG03063hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0039 nrc1 VNG1807 vng1807 no entry
tucHOG0039 hmu HMUK1637 Hmuk_1637 conserved hypothetical protein
tucHOG0039 hma RRNAC1319 hypothetical protein
tucHOG0039 hma RRNAC3355 hypothetical protein
tucHOG0039 hwa HQ3318A hypothetical protein
tucHOG0039 hla HLAC2115 Hlac_2115 hypothetical protein
tucHOG0039 hla HLAC1944 Hlac_1944 hypothetical protein
tucHOG0039 hbo HBOR07590 Hbor_07590 hypothetical protein
tucHOG0039 hut HUTA0065 Huta_0065 conserved hypothetical protein
tucHOG0039 hvo HVO_2347 HVO_2347 conserved hypothetical protein
tucHOG0039 nph NP0228A hypothetical protein
tucHOG0039 nph NP4514A hypothetical protein
tucHOG0039 nph NP4966A hypothetical protein
tucHOG0039 hhi 1908 HAH_1908 hypothetical protein
tucHOG0039 hhi 594 HAH_0594 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2115|hp|hla       ------------------------------------------------------------
4966|hp|nph       MTERIDLDDMAVEEKAEDPDGNYGDWLWRGEGDPDDEPSPGWT-----------------
11319|hp|hma      MTDEIDLDELDVQDDEETP--NRGDWFWSDEGDPVDEPDTGATGTESVRPDSDAEAGSPA
1908|hp|hhi       MTDEIDLDELDVQDDEETP--NRGDWFWNGKGDPEDEPDPGSTGTVSVRPDSDTEAESPG
228|hp|nph        ------------------------------------------------------------
65|chp|hut        ------------------------------------------------------------
1807|hp|nrc1      ------------------------------------------------------------
3318|hp|hwa       ------------------------------------------------------------
1944|hp|hla       ------------------------------------------------------------
7590|hp|hbo       ------------------------------------------------------------
13355|hp|hma      ------------------------------------------------------------
594|hp|hhi        ------------------------------------------------------------
4514|hp|nph       ------------------------------------------------------------
                                                                              

2115|hp|hla       -----------------------------------------MGIDIDDPDPGDRTG----
4966|hp|nph       -------DGDTEATSESEESTGGGPDRQAAPGVPSTGGGGPVGVPEDRGGAGGGTS----
11319|hp|hma      AAINTSPDAATDAERNSGETASADPGGQAVPHVPRENKDKPVGIPTDSGGAGGAAATDTD
1908|hp|hhi       AAADTGPASDTGVEGNGGDTASADPGGQAVPHVPRENKDKPVGIPTDSGGAGGAAATDTD
228|hp|nph        ----------------------------------------------MT---DDAE-----
65|chp|hut        ---------------------------------------------MDADADG--------
1807|hp|nrc1      --------------------------------------------MSQS---GGST-----
3318|hp|hwa       -----------------------MTNSIYSIHSKKKSKTAHSRVRTDGGAPGGDA-----
1944|hp|hla       ---------------------------------------------MDS---GGST-----
7590|hp|hbo       ---------------------------------------------MDG---GGST-----
13355|hp|hma      ---------------------------------------------MD----GGSG-----
594|hp|hhi        ---------------------------------------------MD----GGSG-----
4514|hp|nph       ---------------------------------------------MNG---GGSS-----
                                                                     .        

2115|hp|hla       ---------------------------DVTLVFSLGAARRLSDPEAAIANARKWSRHVGI
4966|hp|nph       -GSAAENTPGGGIEQAGTAETHDVDIDDMTMALTYKAAHHFTEPQRVFAEAREWADWVGV
11319|hp|hma      PASNVAEDPAAGEASVEASGPHGGGIDDMTMAVTYDAARQFADPQLVFREARGWADWVGI
1908|hp|hhi       PASNVAEDPAAGEEAVEASGPHGGGIDDMTMAVTYDAARQFADPQLVFREARAWADWVGI
228|hp|nph        ---------------------------RITLAFELAALERLADPAGVIRDTMGWTSHLGI
65|chp|hut        ---------------------------EMTLAFDIDALQHLAHPDTVFSDARQWSKYVGI
1807|hp|nrc1      ---------------------------DMTLAFELSALKQLAKPGTAFAGARQWTEYVGV
3318|hp|hwa       ---------------------------DMTLAFELEALRALADPNSVFNDARQWTEYVGV
1944|hp|hla       ---------------------------DMTLAFELKALKALADPNDVFNNARQWTEYVGV
7590|hp|hbo       ---------------------------DMTLAFELEALKALADPNVVFNDARQWTEYVGV
13355|hp|hma      ---------------------------DMTLAFDLDALKQLAYPDSVFNDARQWSEYVGV
594|hp|hhi        ---------------------------DMTLAFDLDALKQLAYPDSVFNDARQWSEYVGV
4514|hp|nph       ---------------------------DMTLAFELEALKELEDPEAVFSDARSWSEYVGV
                                              :*:..   *   :  *  .:  :  *:  :*:

2115|hp|hla       VANDAD-AVERFVRETGVENDYTLRN-WDKWGTLGDIHEE--SGAPRAVFVGASTANRRV
4966|hp|nph       VGEVSTPAIRKFQREAGVELDFFGGSESGPDERLADIDAESMFYAERMVVVGVDG-DEWI
11319|hp|hma      VGDVEAFVINKFQRDHGIDADFFSGAGQEPAERLADIDKHSMFYAERMVLVGRPD-DEPI
1908|hp|hhi       VGDVEAFVINKFQRDHGIDADFFSGAGQEPAERLADIDTHSMFYAERMVLVGRPD-DEPI
228|hp|nph        ISDEPTHLVRKRARDYGFNPDFLPGP-RSRHESLPKVKGQPEHDADRYILVAAHDDIEDA
65|chp|hut        VSEEPTYVVTNFARKHRIRQDFFSGP-RGRAESFETIKDQ--FETPRYVYVGTDEVAAEA
1807|hp|nrc1      VSDEPTYVVTNFTRKRRIRQDFFSGP-KSRADSLQSVKEQ--FDTERHVFVGIDDEDREL
3318|hp|hwa       VSEKPTYVVTNFTRKHRVRQDFFSGP-RGVEASLENVKQQ--FETARHVLVSNDQTDADV
1944|hp|hla       VSEKPTYVVTNFTRKHRVRQDFFSGP-RGVEESLENIAQQ--FDTDRHVFVGVDEEDEAL
7590|hp|hbo       VSDKPTYVVTNFTRKHRVRQDFFSGP-RGVEESLNNVKRQ--FDTDRHVFIGTTDEHREL
13355|hp|hma      ISEQPTYVVTNFTRKHRIRQDFFSGP-RGREESLENVKEQ--FDTDRHVFVGADDEDADL
594|hp|hhi        ISEQPTYVVTNFTRKHRIRQDFFSGP-RGREESLENVKEQ--FDTDRHVFVGADDEDADL
4514|hp|nph       ISEKPTYVVTNFTRKNRIRQDFFSGP-RGREESLENVESQ--FQTERHVFVGTDEDDEAL
                  :.:     : .  *.  .  *:           :  :       : * : :.        

2115|hp|hla       ATHVGFEYLPIDEAAEKAGWALSEPERSSESGVISRLWRALRARLD
4966|hp|nph       ADAADWEFVPLEHAAEKADWELKEEFLD------------------
11319|hp|hma      AERTGWEFIPLADAAEKADWDLADE---------------------
1908|hp|hhi       ADRTGWEFIPLADAAEKAEWELADE---------------------
228|hp|nph        AERHGWEYRPVAEAAETAGWVLATETDDD----------EEHTGWP
65|chp|hut        ARSNGWEYLDVEDAAEAAEWELGEPEVPSAE-DTA----ETRDDWP
1807|hp|nrc1      AERVDWEYLTLEAAAENADWEIAEADEPDPMPDEP----E-RDDWP
3318|hp|hwa       AESVDWEFLPLDNAASAAGWELAEATETD-DPFES----NERDDWP
1944|hp|hla       AEATGWEFLHVEDAADAAGWILATDKPDEEEAPEK----SSRDDWP
7590|hp|hbo       AERTEWEFLPLDQAAEAADWDLAGETEDE-DPFET----SSRDDWP
13355|hp|hma      AETAGWEYLPVTQAAEAADWDLGEPETPDTATDED----EQRDDWP
594|hp|hhi        AETAGWEYLPVTQAAEAADWDLGEPETPDTATDED----EQRDDWP
4514|hp|nph       AESVDWEYLPITEAAEAAGWTLAEDE-PESEP-EP----ERRDDWP
                  *    :*:  :  **. * * :