HOG Organism Gene ID Name Annotation
aHOG3899 hla HLAC2117 Hlac_2117 PfkB domain protein
aHOG3899 nrc1 VNG2516 vng2516 no entry
MUSCLE (3.6) multiple sequence alignment


2117|gene|hla      MTDSPPVLAVGAAAIDEWYAVSNLPEPDGGAFASEVTTAFGGVGANVCVALDRLGREVGL
2516|chp|nrc1      ---MAAVVAVGSAVLDRVYGLSNLPAPDGGAFVRDYTERAGGVAANVACALAALDHDAAV
                       ..*:***:*.:*  *.:**** ******. : *   ***.***. **  *..:..:

2117|gene|hla      VSRVGDDEYGRRAFEYLADTGVDASRVSVGNDPSTRSVILSDPAGERTIVTTGESFRRLR
2516|chp|nrc1      VSRVGRDDAGDRVRASLAEWGVDATRVRRGDDATSYALVLRGPEGNRMIVAGGDAVPGVA
                   ***** *: * *.   **: ****:**  *:*.:: :::* .* *:* **: *::.  : 

2117|gene|hla      LNETDREALAAADIVFLTGYTPDAVSRAVLDTIESAADPPALVFDLSGSVEELVGRGTES
2516|chp|nrc1      LTSSDRDALRAADCVFTSAYAPDGVVRDLV-ALRRSGAVSALAFDLAGPRAELDGRGAAA
                   *..:**:** *** ** :.*:**.* * :: ::  :.  .**.***:*.  ** ***: :

2117|gene|hla      ETIHRYLHAADLFVADDVAAAAYFG-GPDAAVDRVAAAQQAREANGRSPVTGDGWPRAVL
2516|chp|nrc1      DTVDAAAATADLFVANAGAADSHVGVGPERAASEFAAM---------------GASRVAV
                   :*:     :******:  ** ::.* **: *.. .**                * .*..:

2117|gene|hla      THGADGMTVVADGAVTEFDAFDVDVVDATGAGDSFVAGLIDRWIAGSDSGDDPRRERAGV
2516|chp|nrc1      TDGSDGAFLATPATTVHAPARAVDVTDTTGAGDAFTAALVHAWVLGD----------AGV
                   * *:**  :.: .:..   *  ***.*:*****:*.*.*:  *: *.          ***

2117|gene|hla      ADGVRFAAAVAAINCTSRFAQTGLPTRDDVEAFLAERGF
2516|chp|nrc1      RDAGRIAAAAAAQNCTREGARGGLASPSDLPD-------
                    *. *:***.** ***   *. **.: .*: