HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0389COG0613arCOG00302Predicted metal-dependent phosphoesterases (PHP family)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0389 nrc1 VNG2493 php no entry
cHOG0389 hmu HMUK1115 Hmuk_1115 PHP domain protein
cHOG0389 hma RRNAC2920 hypothetical protein
cHOG0389 hwa HQ3441A hypothetical protein
cHOG0389 hla HLAC0013 Hlac_13 PHP domain protein
cHOG0389 hbo HBOR01310 Hbor_01310 predicted metal-dependent phosphoesterase, PHP family
cHOG0389 hut HUTA1933 Huta_1933 PHP domain protein
cHOG0389 hvo HVO_0091 HVO_0091 PHP domain protein
cHOG0389 nph NP0722A hypothetical protein
cHOG0389 hhi 184 HAH_0184 PHP domain-containing protein
MUSCLE (3.6) multiple sequence alignment


1933|gene|hut      ---------MIVADLHVHTTRSDGTLPPDAVSDAARAADLRAVAVTDHDRL-PPFDAPVV
722|hp|nph         ---------MVVADLHVHTQNSDGSLTLGAIPEAAKAAGLSTVAVTDHDRLHPEMRTPVA
2493|chp|nrc1      ---------MVHADLHVHTTNSDGTLTIDAVPDAAHDAGVTAVAITDHDRLHPALDAPVT
12920|hp|hma       ---------MVVADLHVHTTRSDGTLSFDEVPAAARRAGVEVVAVTDHDRLQPALDGPAT
184|gene|hhi       ---------MVVADLHVHTTRSDGTLSFDEVPAAARRAGVEVVALTDHDRLQPALDSPVT
3441|hp|hwa        MTTNSAETDAPSADLHIHTTASDGLLTIDELPEVAHKAGIDTVAVTDHDRIHPELATPVS
1310|hp|hbo        -----------MADLHLHTTASDGVLTIAEVPDAAVAGGVEVVAVTDHDRVHPDLDAPVT
13|gene|hla        -----MDTDRIVADLHAHTTVSDGTMTADELVDVARETGLDWVAITDHDRVHPDLSAPVV
                               **** **  *** :.   :  .*   .:  **:*****: * :  *. 

1933|gene|hut      ERDGVTVIAGVELRVTAGDQQLDLLGYGVDPTPALRAETERLQRDRIERAREIVDCVEGR
722|hp|nph         ELDGITVVHGIELRVEADDQRVDLLGYGVRRTEALSALVDRLQTDRKERGAAIIDRVEAE
2493|chp|nrc1      VRDDITVIHGIELRVDTGPQRVDLLGYGVHGTDALTAECDRIQRDRRDRGRRIIDRVEAR
12920|hp|hma       QRDGVTLLHGIELRVETETQRLDLLGYGVDPTDELRTECARIQRNRRERGARIIECVEDR
184|gene|hhi       DRDGVTLLHGIELRVETGTQRLDLLGYGVDPTDELRAECERIQRNRRERGARIIECVEDR
3441|hp|hwa        TKGAVTIIRGIELRVSAGDQRLDLLGYAVRRTDSLIELTTSIQQNRKKRGAAMVDAVESY
1310|hp|hbo        ERDGVTMIRGVELRVETPEQRLDLLGYAVRDTPAIREVTERIQTDRKERGRKIVENVESH
13|gene|hla        ERDDLRVVRGIELRVDAGFERLDLLGYAVGHTEALDAEIERLQTDREQRGAAIVDAVEDR
                     . : :: *:**** :  :.:*****.*  *  :      :* :* .*.  ::: **  

1933|gene|hut      LGIDLGLDVHPGVGRPHIAQAVADS-HGHYTVQDA-FDQLIGTDQPCYVARDLPTVERGR
722|hp|nph         LGTELPVEPRAGLGRPHIAAAIEQV--SDYSYGAA-FEELIGDGRPCYVARDVPDFETGV
2493|chp|nrc1      LGVSLPLEPRPGLGRPHIARAITAHPDTDYDTMDAVFDSLIGNDGPCFVARDVPDFETGV
12920|hp|hma       LGVSLPVEPRDGLGRPHIARGIAEV--SDHTFQSA-FDELIGDDCPCYVPREVPSFERGC
184|gene|hhi       LGVSLPVEPRDGLGRPHIAHGIAEV--SDHTFQSA-FDELIGDDCPCYVSREVPSFERGC
3441|hp|hwa        LDISLDIDIRKGLGRPDIARAIHES-DAPYDYSDA-FSEVIGSENPCYIQRDIPSFDTGA
1310|hp|hbo        LDVELDIELREGIGRPNIARAIEGS-DAPYDYEDA-FAHLIGNDGPCYVQRYVPDFETGV
13|gene|hla        LGVDLGVEPRSGLGRPHIARAIDES-SAPYDYAGA-FDELIGNDGPCYVAREVTKLERGV
                   *. .* :: . *:*** ** .:       :    * *  :**   **:: * :. .: * 

1933|gene|hut      ELLDDAAALVGLAHPLRYDDPDAALAHAGSLDAIEREYPYERAVDR------TPIDDAIE
722|hp|nph         SVLDAACGVVSLAHPHRYADTEAALSLCADLDAVERHYPYDRAVDH------RPVERAIE
2493|chp|nrc1      DLLTDACGLVGLAHPLRYDDPQHALALCAALDAVEAHYPYDRPVGTAPDDGAALVADAID
12920|hp|hma       AVLSDACGLVGLAHPFRYPDTAAALSKCASLDAVERWYPYGRAVDD------SLVDDAIE
184|gene|hhi       AVLSEACGLVGLAHPFRYPDTAAALSKCASLDAVERWYPYGRTVDD------SLVDDAIE
3441|hp|hwa        GVLADACSVIGLAHPFRYPDPAAALKRAEKLDAVERYYPYSGQNADRADP--VVIEDVAT
1310|hp|hbo        AALRESCAVVGLAHPFRYPDPEAALERAAELDAVERFYPYGGGSAAKEDV--ELVERIAA
13|gene|hla        ELLRDACALVGLAHPFRYDDVGAALDVARELDAVERFYPYGRAVDD------ALVERVAA
                     *  :..::.**** ** *   **  .  ***:*  ***              :     

1933|gene|hut      AHDLLATGGSDAHGETLGIAGLGRATSERFCTALDAALSTV-
722|hp|nph         RYDLLVTGGTDAHGETLGVAGLDGRDYRTFRTAL--------
2493|chp|nrc1      THDLIPTGGTDAHDHTLGTAGLDRDAYAAVRTRLAG------
12920|hp|hma       RYDLVPTGGSDAHGETLGDTGLDSPAWDRVETALNV------
184|gene|hhi       RYDLVPTGGSDAHGETLGDTGLDAAAWGRVETALSV------
3441|hp|hwa        NADLLLIGGSDAHNRTVGITGPPPADFEPFATRVS-------
1310|hp|hbo        ANDLLLTGGSDAHDRTLGVAGPTEDAFAAFAARVPGV-----
13|gene|hla        ESDLLLTGGTDAHERTLGEAGLTAEAFAPVRERLPNPIAESP
                     **:  **:***  *:* :*        .   :