HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0388COG0050KOG0460arCOG01563GTPases - translation elongation factorstranslation initiation factor eIF-2 subunit gamma

HOG Organism Gene ID Name Annotation
cHOG0388 nrc1 VNG2056 eif2g translation initiation factor eIF-2 subunit gamma
cHOG0388 hmu HMUK0730 Hmuk_0730 protein synthesis factor GTP-binding
cHOG0388 hma RRNAC2827 eif2G translation initiation factor IF-2 subunit gamma
cHOG0388 hwa HQ1335A tif2g translation initiation factor IF-2 subunit gamma
cHOG0388 hla HLAC2398 Hlac_2398 protein synthesis factor GTP-binding
cHOG0388 hbo HBOR05060 Hbor_05060 translation initiation factor 2 subunit gamma (aeIF-2g)
cHOG0388 hut HUTA2209 Huta_2209 protein synthesis factor GTP-binding
cHOG0388 hvo HVO_1901 HVO_1901 eIF2g translation initiation factor eIF-2 subunit gamma
cHOG0388 nph NP5084A tif2g translation initiation factor IF-2 subunit gamma
cHOG0388 hhi 106 eif2G translation initiation factor IF-2 subunit gamma
MUSCLE (3.6) multiple sequence alignment


2398|gene|hla       -MTEVNTQPEVNIGLVGHVDHGKTTLVQALSGSWTDQHSEEMKRGISIRLGYADATFRRC
1335|gene|hwa       -MTQQTQQPEVNIGLVGHVDHGKTTLVQALSGSWTDQHSEEMKRGISIRLGYADATFRMI
5060|gene|hbo       MVTQNPQQPEVNIGLVGHVDHGKTTLVQALSGSWTDQHSEEMKRGISIRLGYADATFRKI
2056|gene|nrc1      -MADEHRQPEVNIGLVGHVDHGKTTLVRALSGEWTDQHSEEMKRGISIRLGYADATLRRC
5084|gene|nph       -MTQKHRQPEVNIGLVGHVDHGKTTLVESLSGEWTDQHSEEMKRGISIRLGYADATFREC
2209|gene|hut       -MTGTHGHPEVNIGLVGHVDHGKTTLVEALSGEWTDQHSEEMKRGISIRLGYADATFRRC
12827|gene|hma      --MTSNKQPEVNIGLVGHVDHGKTTLVQALSGEWTDQHSEEMKRGISIRLGYADATFRRC
106|gene|hhi        ----------MNIGLVGHVDHGKTTLVQALSGEWTDQHSEEMKRGISIRLGYADATFRRC
                              :**************** :***.***********************:*  

2398|gene|hla       PGVDAPECYTVDEECEDGS-ESEPIRTVSFVDAPGHETLMATMLSGASIMDGAVLVVSAT
1335|gene|hwa       SNINPPEGYTVDETGPDGE-PTETLRTVSFVDAPGHETLMATMLSGAAIMDGAVLVVSAT
5060|gene|hbo       PGADPPECYTVEETDDDGN-ETDVLRTVSFVDAPGHETLMATMLSGAAIMDGAVLVVSAT
2056|gene|nrc1      PDCDEPECYTVAETCPEHDTATEIERTVSFVDAPGHETLMATMLSGAALMDGAVLVVGAN
5084|gene|nph       PELDEPDRYTVEETCPDGS-ESEHLRTVSFVDAPGHETLMATMLSGAAIMDGAVLVIAAN
2209|gene|hut       PEGEDAAGYTVAEECPEHDVETDVLRTVSFVDAPGHETLMATMLAGAAIMDGAVLVISAT
12827|gene|hma      PEAEEPEAFTVDEHCDDHDVDTDHLRTVSFVDAPGHETLMATMLSGAAIMDGAVLVISAT
106|gene|hhi        PEAEEPEAFTVDEHCDDHDVDTDHLRTVSFVDAPGHETLMATMLSGAAIMDGAVLVISAT
                    .  : .  :** *   : .  ::  *******************:**::*******:.*.

2398|gene|hla       EDVPQAQTEEHLMALDLIGIENIVIAQNKVDLVDRDRAVDNYRQIQEFVEGTVAEDAPIV
1335|gene|hwa       EDVPQAQTEEHLMALDIIGIENVVIAQNKIDLVDRERAIESHNQIQSFVEGTVAEDAPIV
5060|gene|hbo       ENVPQAQTEEHLMALDIIGIDNIVIAQNKIDLVDRDRAVENYEQIQEFVQGTVAEDAPIV
2056|gene|nrc1      EPVPQPQTEEHLMALDIIGIENIVIAQNKVDLVDAEEARQNYEEIQAFVEGTVAEDAPVV
5084|gene|nph       EPVPRAQTEEHLMALDIIGIDNIVIAQNKIDLVDREQALDNYEAIEEFVDGTVAEDAPVV
2209|gene|hut       EDVPQAQTEEHLMALDIIGIDNIVVAQNKVDLVDADQARRNYEQIQDFIEGTVAEDAPIV
12827|gene|hma      EPVPQAQTEEHLSALDIIGIDNIVIAQNKVDLVDEERAMQNYEQIQEFVEGTVAEGAPVV
106|gene|hhi        EPVPQAQTEEHLSALDIIGIDNIVIAQNKVDLVDEERAMQNYEQIQEFVEGTVAEGAPVV
                    * **..****** ***:***:*:*:****:**** : *  .:  *: *::*****.**:*

2398|gene|hla       PVSAQQEVNMDLLIDAIESEIPTPDRDPGESARMYAARSFDINRPGATAAELKGGVVGGS
1335|gene|hwa       PVSAQQAVNIDLLIDAIEREIPTPERDADTSPRLYAARSFDINRPGTTWKNLSGGVIGGS
5060|gene|hbo       PISAQQEVNIDLLIDAIEREIPTPEHDESEAARMFTARSFDINRPGTTWEDLSGGVIGGS
2056|gene|nrc1      PVSAEQEINVDLVIDALQTEIATPDRDPSADPLLYAARSFDINRPGTEWGGLLGGVIGGS
5084|gene|nph       PISAQQDVNMDLLMQTIESEIPTPDRDPDADARLQVARSFDINRPGTTWEDLTGGVLGGS
2209|gene|hut       PISAGQNVNMDLLIEAVEEEIPTEDRDLDADAEMLVARSFDINRPGTTWDSLSGGVLGGS
12827|gene|hma      PISAGQEANIDLLIEAVQSEIPTPERDPDEDARMMVARSFDINRPGTTWDDLMGGVLGGS
106|gene|hhi        PISAGQEANIDLLIEAVQSEIPTPERDPDEDARMMVARSFDINRPGTTWDDLMGGVLGGS
                    *:** *  *:**:::::: **.* :.* .  . : .**********:    * ***:***

2398|gene|hla       LVSGELSVGDGLEIRPGREVDEEGQTEWRPLETTVRSLQAGSNDVESARPGGLLGVGTGL
1335|gene|hwa       VSRGRLETGAEIELRPGREVDQGGQVEWQPIITDVRSLQAGGESVSEVTPGGLCGVGTGL
5060|gene|hbo       VVEGKLTEGEELELRPGREVDEGGQTEWRPITTDIRSLQAGGQMTDEVRPGGLCGVGTGL
2056|gene|nrc1      LVDGELEAGDELELRPGREVEEGGKTEWRPVTTDVRSLQAGGEDVDSASPGGLLGVGTGL
5084|gene|nph       LTQGQLEADDDIEIKPGREIEEGGQSEYQPVETTVRSLQAGGEFVDTVTPGGLLGVGTGL
2209|gene|hut       LAQGSLEADDEIELRPGREVEEGGQTEWRPVTTTVRSLQAGGEGVDEVTPGGLLGVGTGL
12827|gene|hma      LVGGQLDADDEIELRPGREVEEGGKTEWQPVTTTVRSLQSGGDFVDTVTPGGLLGVGTGL
106|gene|hhi        LVGGQLDADDEIELRPGREVEEGGQTEWQPVTTTVRSLQSGGDFVDTVTPGGLLGVGTGL
                    :  * *  .  :*:.****::: *: *:.*: * :****:*.: .. . **** ******

2398|gene|hla       DPSLTKGDALAGQVAGEPGTLPPTRNEFEMQVDLLDRVIGSEEGDDGDVEDINTGEPLML
1335|gene|hwa       DPSLTKGDSLAGQIVGEPGTLPPTRESFTMTVELLDRVVG-DEA--GEVETISTGEPLML
5060|gene|hbo       DPSLTKGDALAGQVAGEPGTLPPTREEFTMDVELLNRVVG-EDE--ETVEEISTGEPLML
2056|gene|nrc1      DPSLTKGDALAGQVAGPPGSLPPTWESFEMDVDLLERLVGAADG--EQIDDISTGEPLML
5084|gene|nph       DPSLTKGDALAGQVAGPPGSLPPTRESFTMDVELLDRVVG-EDA--EEIEPISTGEPLML
2209|gene|hut       DPSLTKGDALAGQIAGPPGTLPPVQEEFTMDIQLLDRIVA-EDT--DEVEEISTGEPLML
12827|gene|hma      DPAITKGDALAGQVAGPPGSLPPVHETFTMDVDLLERIVG-DDG--GEVDEISTGEPLML
106|gene|hhi        DPAITKGDALAGQVAGPPGSLPPVHETFTMDVDLLERIVG-DDG--GEVDEISTGEPLML
                    **::****:****:.* **:***..: * * ::**:*::.  :     :: *.*******

2398|gene|hla       TVGTATTVGAVTSAREGECEVSLKRPVCAEKGAQIAINRRVGARWRLIGVGTLS---
1335|gene|hwa       TVGTATTVGAVTSARSGEAEVSLKRPVCAEEGSKIAINRRVGARWRLIGIGTLE---
5060|gene|hbo       TVGTATTVGAVTSARTGEAEVSLKRPVCAADGAKIAINRRVGARWRLIGIGTLK---
2056|gene|nrc1      TVGTATTVGSVTSARDGECEVALKRPVCAPAGAKIAINRRVGARWRLIGVGTLTESE
5084|gene|nph       TVGTATTVGSVTSARDDECEVQLKRPVCAPDGSKIAINRRVGARWRLIGVGTLR---
2209|gene|hut       TIGTATTVGSVTSARDGEAEVALKRPVCAREGAKIAINRRIGARWRLIGVGTLRE--
12827|gene|hma      TIGTATTVGSVTSARDDECEVALKRPVCAASGSKIAINRRVGARWRLIGVGTLR---
106|gene|hhi        TIGTATTVGSVTSARDEECEVALKRPVCAASGSKIAINRRVGARWRLIGVGTLR---
                    *:*******:*****  *.** *******  *::******:********:***