HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0386COG1985arCOG01484Pyrimidine reductase riboflavin biosynthesisriboflavin-specific deaminase

HOG Organism Gene ID Name Annotation
cHOG0386 nrc1 VNG1256 ribG riboflavin-specific deaminase
cHOG0386 hmu HMUK2416 Hmuk_2416 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)p yrimidine1-reductase( EC:1.1.1.193 )
cHOG0386 hma RRNAC1131 ribG hypothetical protein
cHOG0386 hwa HQ2510A ribG hypothetical protein
cHOG0386 hla HLAC0451 Hlac_451 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine 1-reductase
cHOG0386 hbo HBOR18920 Hbor_18920 2,5-diamino-6-(5-phosphoribosylamino)pyrimidin- 4(3H)-one reductase( EC:1.1.1.193 )
cHOG0386 hut HUTA0543 Huta_0543 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)p yrimidine1-reductase
cHOG0386 hvo HVO_1341 HVO_1341 diaminohydroxyphosphoribosylaminopyrimidine reductase
cHOG0386 nph NP2672A ribG hypothetical protein
cHOG0386 hhi 1738 ribG 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine1-reductase
cHOG0386 hhi 5124 HAH_5124 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


5124|hp|hhi         MDRRTARLLNGVLALCCLALVFAAVYPFSTASPHAENPVDERFTVPESDEYRASGAIVAD
2510|hp|hwa         --------------------MHVVVNAAISIDGKLSTRRREQVAISGERDFERVSELRAN
2672|hp|nph         --------------------MDVTVNAAMSADGKLSSRRREQIAISGDADFERMYRLRAA
451|gene|hla        --------------------MHVVVNAAQSVDGKLATRRREQLRISGPEDFDRVDRVRAA
11131|hp|hma        --------------------MHVIVNAAMSVDGKLSSRRREQIAISGPDDFDRVDQLRAD
1738|gene|hhi       --------------------MHVVVNAAMSVDGKLSSRRREQIAISGPDDFDRVDQLRAD
543|gene|hut        --------------------MHVVVNAAMSADGKLSTHDREQVAISGEADFDRVDGLRAD
18920|gene|hbo      --------------------MHVVVNAATSADGKLSTRRREQIKISGADDFARVDRVRAD
1256|gene|nrc1      --------------------MHVVVNAAMSADGKLSTRRREQVTLSGDADFERVDELRAS
1341|gene|hvo       --------------------MHVHVNAAASLDGKLSSRRREQVTISGDDDFARVDEIRAT
                                        : . * .  : . :  .   *.. :.   ::     : * 

5124|hp|hhi         SETALEFEGAVTADGGRYLFIDEGDVRTEQYQASPGDPVYSRIVVDDDGSTDRRREQIQS
2510|hp|hwa         NDAILVGIGTVLADDPHLVVEGS-YRKRRQDQGLIPTP--HRIIIDS---------RART
2672|hp|nph         VDAVLVGVGTVLADNPSLRSHDEAHRAEVYGPDADP-P--ARVVADS---------ACRT
451|gene|hla        ADAVLVGVGTVLADDPHLTLDEEDRRVERLRNGRPGNP--ARVVVDS---------TGRT
11131|hp|hma        SDAVMVGVGTILADDPSLTVDDADRRAARAERGDPENP--ARVIADS---------RIRT
1738|gene|hhi       SDAVMVGVGTILADDPSLTVDDADRRAARADRGKPENP--ARVVADS---------RIRT
543|gene|hut        SDAVMVGVGTVLADDPSLTVDDPDRIAQRGDRGDPPQP--ARVVADS---------RART
18920|gene|hbo      SDAVLVGVGTVLADDPHLTVDDADYRDERQSDGREPHP--ARVVADS---------RART
1256|gene|nrc1      VDAVMVGVGTVLADDPSLTLDDSGHVAAREERGESPHP--ARVVADS---------HART
1341|gene|hvo       ADAVAVGVGTVLADDPHLTLDDPGLVAAREDRGDSPHP--ARVVADS---------RART
                     ::     *:: **.                      *   *:: *.           .:

5124|hp|hhi         DTDRELLQETRTDGAVTFILKQESE--DVADDVSGAASVVVRSLYLVEYERE-------A
2510|hp|hwa         PTDAEVLD----DEAPTYIIVSESAPTSRQADLEVEGANVMI----AGRDR--------V
2672|hp|nph         PPDADILA----GEPDTYVLTSGAAPEDRRAALREAGAELIV----TDGDR--------V
451|gene|hla        PTDARILD----DAATTYLLVSASAPPERREALAAAGAEVVVVEGGSGTERESESDGDHV
11131|hp|hma        PPDATVLD----GRAQTYLLVSEAAPPDFIEEMEDAGAYVIA----AGQDR--------V
1738|gene|hhi       PPDATVLD----GRAQTYLLVSEAAPPDFIEEMEDAGAYVIA----AGQDR--------V
543|gene|hut        PPDAQILD----DEAETYLVVGERAATEKVERLESTGATVIA----AGHDR--------V
18920|gene|hbo      PTDARILD----DAATTYVLVSESAPADRVSALEKTGGTVVT----AGDTR--------V
1256|gene|nrc1      PPDARLLD----GAAETYVLVAEAEPVEHRESLEAAGATVVV----AGENR--------V
1341|gene|hvo       PTDARILD----DAATTYLLVSEAAPGGRREALEAAGAELVV----AGAER--------V
                     .*  :*     . . *:::            :   .. ::         *        .

5124|hp|hhi         DAAQAATVYKPKNGWYEGRETYHVTGATGTVRTVGDTTDVRSATVTWDLTKSAGTY-AEL
2510|hp|hwa         SMPAALSALADS-----GMSSIMVEGGGEIIFSLFEA----------NLVDELSVYVGSM
2672|hp|nph         SLSTAFAELAAR-----GIDRLMVEGGGELIFSLFEA----------GLVDSLSVYIGDL
451|gene|hla        DLVAGIHALAER-----GIDRLMVEGGGEVIYSCFAA----------GLVDELHVYVGSM
11131|hp|hma        DLTTTLAKLEGD-----GIDQLMVEGGGELIFSLLEE----------ALVDELFVYVGPK
1738|gene|hhi       DLTTTLAKLEGD-----GIDQLMVEGGGELIFGLLEE----------ALVDELFVYIGPK
543|gene|hut        DLSAGLDALESH-----GIDRLMVEGGGELIFSLFAD----------DLVDELSVFVGPM
18920|gene|hbo      SFPEAFAELEAR-----GIDRLMVEGGGEVIFSLFED----------ELVDELSVYVGSV
1256|gene|nrc1      DLPSALDALESR-----GVDRLMVEGGGELIFSLFAE----------ELVDELSVFVAPQ
1341|gene|hvo       SLPDAFDALEAR-----GVDRLMVEGGGELIFSLFEA----------GLVDELTLYVGSL
                    .                * .   * *.   :                 *...   : .  

5124|hp|hhi         ALGRLAGKAPETYDLSFEFDSGETTVNRPAWVTDARTERSGQSQ----DAS---------
2510|hp|hwa         LIG---GRDAPT------LADGDGFIDDPTQLQLTSVKQIDDGVLLQYDVETTASTYDSI
2672|hp|nph         VIG---GRDAPT------LADGEGFVADFPELELDEVERLDEGVVLYWEVV---------
451|gene|hla        VIG---GRDAPT------LADGEGFTEAFPRLDLVDTERLDDGIVLSYEVGDGTP-----
11131|hp|hma        VIG---GRDAPT------LADGDGFIEDFPEPELADVERVDDGVVLHWQF----------
1738|gene|hhi       VIG---GRDAPT------LADGDGFIEDFPEPELAGVERLDDGVVLHWQF----------
543|gene|hut        LIG---GRDAPT------LADGDGFLEGFPVLDLRDVEQMDGGVLLRWDVA---------
18920|gene|hbo      VLG---GRDAPT------LADGDGFVESFPTLDLRDVERIDDGVLLTYDVV---------
1256|gene|nrc1      LIG---GRDAPT------LADGDGFVAEFPTFELTGVDRLDDGVLLAYDCR---------
1341|gene|hvo       VIG---GRDAPT------LADGDGFVSDFPRLSLRDVERVDDGVLLTYDC----------
                     :*   *. . *      : .*:      .      ... . .     :           

5124|hp|hhi         -
2510|hp|hwa         D
2672|hp|nph         -
451|gene|hla        -
11131|hp|hma        -
1738|gene|hhi       -
543|gene|hut        -
18920|gene|hbo      -
1256|gene|nrc1      -
1341|gene|hvo       -