HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0385COG0045KOG2799 KOG1254arCOG01337Succinyl-CoA synthetase beta subunitsuccinyl-CoA synthetase beta chain

HOG Organism Gene ID Name Annotation
cHOG0385 nrc1 VNG1541 sucC succinyl-CoA synthetase beta chain
cHOG0385 hmu HMUK2714 Hmuk_2714 succinyl-CoA synthetase, beta subunit( EC:6.2.1.5 )
cHOG0385 hma RRNAC0472 sucC succinyl-CoA synthetase beta chain
cHOG0385 hwa HQ2858A sucC succinate--CoA ligase beta subunit (ADP-forming)
cHOG0385 hla HLAC2207 Hlac_2207 succinyl-CoA synthetase, beta subunit
cHOG0385 hbo HBOR10980 Hbor_10980 succinyl-CoA synthetase (ADP-forming) beta subunit( EC:6.2.1.5 )
cHOG0385 hut HUTA0438 Huta_0438 succinyl-CoA synthetase, beta subunit
cHOG0385 hvo HVO_2465 HVO_2465 sucC succinyl-CoA synthase beta subunit
cHOG0385 nph NP4356A sucC succinate--CoA ligase (ADP-forming), beta subunit
cHOG0385 hhi 1167 sucC succinyl-CoA synthetase beta subunit
MUSCLE (3.6) multiple sequence alignment


1541|gene|nrc1      MHTHHMDGARCKRMHPVSKRQHAPDSETDGVYAERGSRSDCMKLHEYQAKEVFADAGIPT
438|gene|hut        -----------------------------------------MRLHEYQAKRVFAEAGIPV
4356|gene|nph       -----------------------------------------MKLHEYQAKGVFADAGIPV
10472|gene|hma      -----------------------------------------MRLHEYQAKQVFADAGIPT
1167|gene|hhi       -----------------------------------------MRLHEYQAKQVFADAGIPT
2858|gene|hwa       -----------------------------------------MRLHEYQAKELFADAGIPV
2207|gene|hla       -----------------------------------------MKLHEHQAKTIFADAGIPV
10980|gene|hbo      -----------------------------------------MRLHEYQAKDIFAEAGIPV
                                                             *.***:*** :**:****.

1541|gene|nrc1      PESALATSVDEAVEVADALDYPVAVKAQVHVGGRGKAGGIKLAENTAEAREAAESILGMD
438|gene|hut        PDATLATTVEEAVDAAGEIGFPVAIKAQVHVGGRGKAGGIKLAEDADEAREAATDILGMD
4356|gene|nph       PESTLASTVDEAVEAADDIGYPVAIKAQVQVGGRGKAGGIKLVENADEAREAADEILGMD
10472|gene|hma      PASQLAETVDEAVDAAEEIGYPVAIKAQVHVGGRGKAGGIKLVESKEEAREAAEDIIGMD
1167|gene|hhi       PASQLAETVDEAVDAAEEIGYPVAIKAQVHVGGRGKAGGIKLVESKEEAREAAEDIIGMD
2858|gene|hwa       PDSQRATSSDEVLTAVEDIGYPAAIKAQVHVGGRGKAGGIKIAGDKQEAKAYAEEILGME
2207|gene|hla       PDSRLATTVDEALDAVDEIGYPAAIKAQVHVGGRGKAGGIKIATDRDEAEQYAEEILGMD
10980|gene|hbo      PESRLATSVDEVMEAVEEIGYPAAIKAQVHVGGRGKAGGIKIATDEDEAREAAEDILGMD
                    * :  * : :*.: ..  :.:*.*:****:***********:. .  **   * .*:**:

1541|gene|nrc1      LKGYTVDRVLVEEAVDFTNELYVGVTMDRSEGAPVVMVSERGGVDIESVAEEAPEDIVRE
438|gene|hut        LKGYTVDRVLVEQAVDFVNELYVGVTMDRGAGKPVAMVSTKGGVNIEEVAAENPDAIARE
4356|gene|nph       LKGLHVDRVLVEAAVDFTDELYVGVTMDRAAGKPVAMVSTRGGVNIEEVAEEDPDAIVRE
10472|gene|hma      LKGYHVSKVLVEEAVDFVNELYVGVTMDRGEGRPVAMVSTKGGVNIEEVAEEDPDAIARE
1167|gene|hhi       LKGYHVSKVLVEEAVDFVNELYVGVTMDRGEGRPVAMVSTKGGVNIEEVAEEDPDAIARE
2858|gene|hwa       IKGYTVNSVLVEASVDFENELYIGITMDRSSGKPVAMVSTEGGVDIESVAAETPDAIARE
2207|gene|hla       LKGYTVDQILVEQGVDFVDELYVGVTMDRGEGQPVLMVSTEGGVNIEEVAEENPDAIARE
10980|gene|hbo      LKGYTVEKVLVEAGVDFENELYVGITMDRGEGKPVAMVSTEGGVNIEEVAEETPEAIARE
                    :**  *. :*** .*** :***:*:****. * ** ***  ***:**.** * *: *.**

1541|gene|nrc1      HVDPSFGLQAYQARNAVYDAGIEQDVAGDVAKIVQGVYDLWADSDATEVEINPVMVTSER
438|gene|hut        HVDPAYGLHPYQARKAVYDAGVDREVAGDVASILSTLYDLWDEKDGSDAEINPVMITDDD
4356|gene|nph       HIDPAFGMHPFQARKAAFEAGVDRAVANDVASILTQLYELWADKDATEIEVNPLMVTDDD
10472|gene|hma      HIDPAFGMHPFQARKVVYEAGVDREVANDVASVLTTLYQLWDDRDGADTEINPLMITSDD
1167|gene|hhi       HIDPAFGMHPFQARKVVYEAGVDREVANDVASVLTTLYQLWDDRDGADTEINPLMITADD
2858|gene|hwa       HIDPVFGLHPYQARRAVYDAGVPSDVASDVAHILSTLYTQYESADASEIEINPVMITTDR
2207|gene|hla       HVDPAFGLHPYQARKVVYEAGVDADVALDVASILTTLYDLYEENDASEIEVNPVMITSDR
10980|gene|hbo      HIDPAFGLHPYQARKVVYEAGIPHDVAGDVATILSTLYDLYESKDASDIEINPVMITSDR
                    *:** :*::.:***...::**:   ** *** ::  :*  : . *.:: *:**:*:* : 

1541|gene|nrc1      DVVAADAVMKLDEDALFRQPAFADMEEDAA-EDDLEAKANEYGFDYVRLDGNTGIIGNGA
438|gene|hut        EVIAADAVFNVDDDALFRQSEIAQLEGETT-DDDLEAMANEYGFDYVRLSGNVGIIGNGA
4356|gene|nph       EVIAADAVMNIDEDALFRHPDLEEMEEEAA-GDELEAKANEYGFDYVRLSGNTGIIGNGA
10472|gene|hma      EVIAADAVMNVDGDALFRQPEIAEMGEEAAEGDELEQKADEYGFDYVRLDGNVGIIGNGA
1167|gene|hhi       EVIAADAVMNIDGDALFRQPEIAEMGEEAAEGDELEQKADEYGFDYVRLDGNVGIIGNGA
2858|gene|hwa       DVVAADAVMNIDEDALFRQPELASMEDTAA-GDDLEIKADEYGFDYVRLDGDVGIIGNGA
2207|gene|hla       DVIAADAVMNIDEDALFRHPDLAEMAEESY-EDDLERKAGEYGFDYVRLSGNVGIIGNGA
10980|gene|hbo      EVVAADAVMNIDSDALFRHPDLAEMEDEAA-EDDLERKANDYGFDYVRLSGNVGIIGNGA
                    :*:*****:::* *****:. : .:   :   *:**  *.:********.*:.*******

1541|gene|nrc1      GLVMTTLDLVDYYGGQPANFLDIGGGAKADRVANALDMVFSDENVDSVVFNIFGGITRGD
438|gene|hut        GLVMTTLDLVDHYGGSPANFLDIGGGAKAGRVRNALEVVFADDNVDSVVFNIFGGITRGD
4356|gene|nph       GLVMTTLDLVDHYGGEPANFLDIGGGAKAERVANALDMVFSDDNVDSVVFNIFGGITRGD
10472|gene|hma      GLVMTTLDLVDYYDGEPANFLDVGGGAKADRIANALDMVFSDENVDSVVFNIFGGITRGD
1167|gene|hhi       GLVMTTLDLVDYYGGEPANFLDVGGGAKADRIANALDMVFSDENVDSVVFNIFGGITRGD
2858|gene|hwa       GLVMTTLDLVDYYGGSPANFLDIGGGAKAERVANALDMVFTDDNVDAIVFNIFGGITRGD
2207|gene|hla       GLVMTTLDLVDYYGGKPANFLDIGGGAKAERVTKALDMVFSDENVDAVVFNIFGGITRGD
10980|gene|hbo      GLVMTTLDLVDYYGGEPANFLDIGGGAKAERVANALDMVFSDENVDAVVFNIFGGITRGD
                    ***********:*.*.******:****** *: :**::**:*:***::************

1541|gene|nrc1      EVAKGINSALEQFDEIPTPVVVRLAGTNAAEGREILNDDLVTVEETLEGAVQRAVEYADE
438|gene|hut        EVARGINEALEEFDTIPNPVTVRLAGTNSVQGMEILNTDLVTVEETLEEAVQRAVADAEE
4356|gene|nph       EVAKGINEALEQFDEIPKPVVVRLAGTNAEEGMEILNTDLVTVEKTLEDAVQRAVKYAEE
10472|gene|hma      EVANGINQALEQFDEIPKPVTVRLAGTNAEEGMEILNEDLVTVEHTLEDAVQRAVEYAKE
1167|gene|hhi       EVANGINQALEQFDEIPKPVTVRLAGTNAEEGMEILNEDLVTVEHTLEDAVQRAVEYAKE
2858|gene|hwa       EVATGINEALEKFDTIPKDVVVRLAGTNAEEGMEILNTDRVEVEATLEDAVEQAVINAQE
2207|gene|hla       EVAKGINEALEQFDEIPKKVVVRLAGTNAEEGMEILNTDLVEVEETLEDAVQRAVKNAEE
10980|gene|hbo      EVAKGINEALESFDEIPKKVVVRLAGTNAEEGMEILNTDLVEVEKTLEDAVQQAVENAQE
                    *** ***.***.** **. *.*******: :* **** * * ** *** **:.**  *.*

1541|gene|nrc1      EDIQ
438|gene|hut        VAQ-
4356|gene|nph       EQ--
10472|gene|hma      VEA-
1167|gene|hhi       VEA-
2858|gene|hwa       VHQ-
2207|gene|hla       VTQ-
10980|gene|hbo      AGQ-