HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0384COG0189arCOG01589Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)ribosomal protein S6 modification protein

HOG Organism Gene ID Name Annotation
cHOG0384 nrc1 VNG0098 rimK ribosomal protein S6 modification protein
cHOG0384 hmu HMUK0657 Hmuk_0657 RimK domain protein ATP-grasp
cHOG0384 hma RRNAC2360 rimK ribosomal protein S6 modification protein
cHOG0384 hwa HQ1392A homolog of lysine biosynthesis regulator/ribosomal protein S6 modification enzyme (glutaminyl transferase)
cHOG0384 hla HLAC2369 Hlac_2369 RimK domain protein ATP-grasp
cHOG0384 hbo HBOR27040 Hbor_27040 SSU ribosomal protein S6P modification protein
cHOG0384 hut HUTA2545 Huta_2545 RimK domain protein ATP-grasp
cHOG0384 hvo HVO_0483 HVO_0483 rimK ribosomal protein S6 modification protein
cHOG0384 nph NP0008A homolog 2 to lysine biosynthesis regulator/ribosomal protein S6 modification enzyme (glutaminyl transferase)
cHOG0384 hhi 2801 rimK2 RimK family alpha-L-glutamate ligase/30S ribosomal protein S6 modification protein
MUSCLE (3.6) multiple sequence alignment


98|gene|nrc1        MLGLAVANDAETFARMQEPLAERGVRAEHVTVTGSVTRLD-----------APPVDADRF
1392|gene|hwa       MLTLAVTTASTTFDRMQEPLTNHDITVEHLQATQRTVDLT-----------QSPTTE--Y
2369|gene|hla       MLRLAMTTDAETFERVRGPLADRGIAIDHVQAKERALRVSGGREREGPSDADDEFDG--F
27040|gene|hbo      MLRLAVTTSSETFDRMQQPLAARDIAVEHLSAVSRTIRLT------------DTADD--F
2545|gene|hut       MLRLAVATQAESYERLRGSLDAHGIEVIALQTSERTIPLG-----------EDPFPD--V
8|gene|nph          MLRLAVATDAETLDRIRDPLADHGIEAEHVPTTERAQPLG------------EPFTETAF
12360|gene|hma      MHRLAVATNAETFERMQAPLAARDIEVGHVETAERTLPLD-----------ESPFDE--Y
2801|gene|hhi       MYRLAVATNAETFERMQGPLAARDIEVGHVKTAERTLALD-----------ESPFDE--Y
                    *  **::. : :  *:. .*  ..:    : .   .  :                     

98|gene|nrc1        DAGFVYPGRLMEGGVVDAFIDVPWVNGREAVLRSRNKAGALALLSDAGVPVPETVYVSNP
1392|gene|hwa       DVGFVYPGRLMEGGVVSARHNIPWVNGRDAILTSRNKAGVLAMLERAEIPVPETRVISNP
2369|gene|hla       DAGFVYPSRLMEGVVVDARLSVPWVNDREAVLTSRNKAGVLAALDAAGIPTPRTTLVSNP
27040|gene|hbo      DVGFVYPTRLMEGGALTAQRQLPWVNGREAVLSSRNKAGVIAALSRAGLPVPETRMVSNP
2545|gene|hut       DVGYVFPSRLMEGGVAAAALSVPWLNGREAVLRSRNKAGTLQRLADAGIPVPETVLISDP
8|gene|nph          DVGFVYPSRLMEGGVADAALDIPWVNGRDAILRSRNKAGALTRLQRADVPVPESVYLSNP
12360|gene|hma      DIGFVYPSRIMEGAVADAMLDVPWVNDREAILRSRNKADVLARLGRADVPVPETVMVSNP
2801|gene|hhi       DVGFVYPSRIMEGAVADAMLDVPWVNDREAILRSRNKADVLARLGRADVPVPETVVVSNP
                    * *:*:* *:*** .  *  .:**:*.*:*:* *****..:  *  * :*.* :  :*:*

98|gene|nrc1        ADEDAVRGVFEALEPPVVVKPNSATRGVGVTKVSDPDSLGGVTDYLELVHDYRATGDKSY
1392|gene|hwa       VEYDAVTAAVDTLSFPVVIKPNSATRGIGVTKVDDIDSLLGTIDYLDLIHDYQATDDKSY
2369|gene|hla       VDEAVVTEAVAPFSYPVVVKPNSATRGVGVATATDLDSLLGVVDYLNLVHDYRATGDKSY
27040|gene|hbo      VDEETVINAVADLSFPLVVKPNSATRGVGVAKVSDVDSLLGVVDYLNLVHDYRATGDKSY
2545|gene|hut       VDRAELVAAFERFDPPVVVKPNSTSRGTGVTLAHDLDSFLGIADYLDLVHDYRATGDQSF
8|gene|nph          VDDATLRAAFEAFDPPVVIKPNSTTRGVGIAKAHDLDSFLGICEYLSLVHDYRAADDRSF
12360|gene|hma      ASEAELTAAFEQFDPPVVVKPNSTTRGVGVAKAHDLDSFLGIVDYLDLVHDYRAVGDQSF
2801|gene|hhi       ASEAELTAAFERFDPPVVVKPNSTTRGVGVAKAHDLDSFLGIVDYLDLVHDYRAVGDQSF
                    ..   :  ..  :. *:*:****::** *:: . * **: *  :**.*:***.*..*.*:

98|gene|nrc1        LIQAFVPDATDYRVMVLDGRVVGAV---------RRDSAGWKHNVHQGATAAGVSLPDRL
1392|gene|hwa       LIQEFLPNARDYRIMVVDGTVVGGVERRISRSHANTDDTRWKHNVHRGATAHGVQIPDQY
2369|gene|hla       LIQEFLPDARDYRAMVVDGAYVGAVERELPPD--AVEEGRWKHNVHRGAAATGVDLPDRA
27040|gene|hbo      LIQEFVPNARDYRIMVLDGEVVGGVERRLPE---SLDEGRWKHNVHRGAEATELTVSERH
2545|gene|hut       LLQEYVPDARDYRVMVLDGEYVGAVERRMPE---TAGRHHWKHNVHHGATPTRVDLSDEH
8|gene|nph          LVQEYLPDARDYRAMVVDGECVGAVERRLPDE--ERRAGRWKHNVHRGATAEGVELPAEH
12360|gene|hma      LVQEYIADAADYRVMVVDGEYVGAVERRLPEA--SREQGRWKHNVHRGADAEGQALPAAL
2801|gene|hhi       LVQEYVADAADYRVMVVDGEYVGAVERRLPDA--SRAQGRWKHNVHRGAEAEGQELPAAL
                    *:* ::.:* *** **:**  **.*               ******.** .    :.   

98|gene|nrc1        RALAVDAAAALDVSLLGVDVLATDERAVVVETNARPTIDDTAKYEAEFYDRLAALVRRTA
1392|gene|hwa       QELALKTAAALDISYLGVDILVTEHRVVVSETNARPTIDDTKKYDADFWDRLAALIHQTA
2369|gene|hla       RELAERTAEALGIDYLGVDLLETDGRLVVNETNARPTVDAATKYKPDFYDRLAGLIERTA
27040|gene|hbo      RELAVSVAEALGIDYLGVDLLVTGELTVVSETNARPTID-HEKYASDFWDRLAALIRRTA
2545|gene|hut       KAVAERVATVLGIPLLGVDLLVTEDRTLVTETNARPTID-AEHYAEGFWEHLATVIRRTA
8|gene|nph          RRLAVATADALDIDWLGVDLLVSGDRAVVNETNARPTVDAATKYEPGFYDQLAALIRRTA
12360|gene|hma      RELAEDAADELAIPYLGVDLLVTEDRAVVNETNARPTIDSATKYEDGFWDDLAALIRQTA
2801|gene|hhi       RELAEDAADELEIPYLGVDLLVTEDRAVVNETNARPTIDSATKYEDGFWDDLAALIRQTA
                    . :*  .*  * :  ****:* :    :* *******:*   :*   *:: ** :: .**

98|gene|nrc1        GDGRA-
1392|gene|hwa       RE----
2369|gene|hla       AGE---
27040|gene|hbo      EQS---
2545|gene|hut       RTDGQQ
8|gene|nph          EQG---
12360|gene|hma      EQ----
2801|gene|hhi       EQ----