HOG Organism Gene ID Name Annotation
aHOG3828 hbo HBOR33750 Hbor_33750 Predicted membrane protein (DUF2178)
aHOG3828 hut HUTA2165 Huta_2165 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


33750|hp|hbo      MSTTNAKPPETSYRRLYTGLWILSGIALGVFIAIGYPLVGVGLFAACAAGSIVVVRRYDG
2165|hp|hut       MSGFLERP--SRIRRVVAGLTVVGAVALAGFTVLERPLVGVTVFGLAITGVMVAMYRTER
                  **    .*  :  **: :** ::..:**. * .:  ***** :*. . :* :*.: * : 

33750|hp|hbo      PLFDERDWTVQAAASKRTLGIMGIVSAIGFPTVTALWALDIIEWPLWLTPIAFFVAALSL
2165|hp|hut       PVFDERDEQISREAAEWTLSLLGISSMLVFPTLTFAWGVDKFEWQPWSTAIAMFVAVLYL
                  *:*****  :.  *::.**.::** * : ***:*  *.:* :**  * *.**:***.* *

33750|hp|hbo      LHLGSTMYEARQYA
2165|hp|hut       IY-GAFLVVLRSQR
                  :: *: :   *.