HOG Organism Gene ID Name Annotation
aHOG3823 hbo HBOR37950 Hbor_37950 hypothetical protein
aHOG3823 hut HUTA1327 Huta_1327 nitrite and sulphite reductase 4Fe-4S region
MUSCLE (3.6) multiple sequence alignment


37950|hp|hbo       ------------------MRTAIATGSTRHFHLVDVHRDAVWNLVQVVAI-------NIF
1327|gene|hut      MNTVEQWKQEKHPLDVIEDVTEYAEDGLSFSEIEDRAGDGEWERLKWAGLYAHGEHDDFF
                                       *  * ..  .  : *   *. *: :: ..:       ::*

37950|hp|hbo       LDVVHLALRW--------------RFLQLLSRFGFEERSTLFGP----------------
1327|gene|hut      MKRTKVPGGYLTPEQAEVIGEVAEEYATAPAEHGGEDQNEIWGDAYLDITTRQDIQMHWI
                   :. .::.  :               :    : .* *:.. ::*                 

37950|hp|hbo       ----------------------VGEVAEPICALPFNGLD---------------------
1327|gene|hut      EVEDVPEIWATYDEVGLTTVQGCGDSARNVLGCPAAGLDGHECFDAQPVIDAVNEFFTEN
                                          *: *  : . *  ***                     

37950|hp|hbo       ---HVLRKRRRRTRLGAGR-----ILHATGVVARHDFLDV-GELKTSND------EVLFL
1327|gene|hut      REYANLPRKFKMTITGCAHDCGQSQINDVGLTPARKEVDVSGEAGGSSDSSDGGKDIYGF
                        * .. . *  *...      :: .*:.. .. :** **   *.*      ::  :

37950|hp|hbo       NVQ---------RSETQEPVVV-----FEFY-----------------------------
1327|gene|hut      HCKVGGGLSDGPRMATQMDVFVPPEDAVEFCRAIAQTFKELGDRSNRGVCRMRYLVEQLG
                   : :         *  **  *.*     .**                              

37950|hp|hbo       --------------DAPAFSFDLEPIVEDDVAGL----------------------EPVA
1327|gene|hut      TEEFEAAVRRRCSVDLPESGVDLTEGYAGDHVGVHDQKQDGLKYVGFNVIAGRMSGEEFV
                                 * *  ..**     .* .*:                      * ..

37950|hp|hbo       DDVSFSDAHGASPVVIR----------------------------------------SGC
1327|gene|hut      EAARAAKKYGTDDASIRLATDQNFLITHIPAENVGDLMAEPFARKYSPDPGPFSRGAVGC
                   : .  :. :*:. . **                                         **

37950|hp|hbo       SG-----------------W--------------------------SC------------
1327|gene|hut      TGSEFCNYGIIETKNRVYRWAKALDRRIETPDDLDVVRMHMSGCSASCAQPQIADIGFRG
                   :*                 *                          **            

37950|hp|hbo       ------------------------------------MVIWTE------------------
1327|gene|hut      ETVKVDDPEDSTNFEGDAIVEGMDFGLGGALGTDNEFLDWVETAVPARAVIPALEELFAA
                                                       :: *.*                  

37950|hp|hbo       -------------WRPS---------------------------------
1327|gene|hut      YTEERNEGERFYAWCRRVENDRLRSIMQRADAPVAAGVAQETGGRGSSDD
                                *