HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0381COG1008arCOG01538NADH:ubiquinone oxidoreductase subunit 4 (chain M)F420H2:quinone oxidoreductase chain M

HOG Organism Gene ID Name Annotation
cHOG0381 nrc1 VNG0647 nuoM F420H2:quinone oxidoreductase chain M
cHOG0381 hmu HMUK1926 Hmuk_1926 proton-translocating NADH-quinone oxidoreductase, chain M( EC:1.6.5.3 )
cHOG0381 hma RRNAC1456 ndhD NADH dehydrogenase subunit 4
cHOG0381 hwa HQ1647A nuoM NADH dehydrogenase, subunit M (ubiquinone)
cHOG0381 hla HLAC0713 Hlac_713 proton-translocating NADH-quinone oxidoreductase, chain M
cHOG0381 hbo HBOR21380 Hbor_21380 NADH dehydrogenase subunit M( EC:1.6.5.3 )
cHOG0381 hut HUTA0693 Huta_0693 proton-translocating NADH-quinone oxidoreductase, chain M
cHOG0381 hvo HVO_0987 HVO_0987 F420H nadh-quinone oxidoreductase chain m
cHOG0381 nph NP2312A nuoM NADH dehydrogenase-like complex, subunit M
cHOG0381 hhi 2037 nuoM NADH dehydrogenase subunit M (ubiquinone)
MUSCLE (3.6) multiple sequence alignment


2312|gene|nph       MFIEALILLCLVGAAAVFIAPDRYAHKLALGLSVPPLVVSLYMY----AAFDGSGNALL-
11456|gene|hma      MWVAALLLVTLLGTGLVFLSPDRYAGKLAAAVSAVPALGSIYMYWVYLTQYGGTGNALLS
2037|gene|hhi       MWVAALLLVTLLGTGLVFLSPDRYAGKLAAAVSAVPALGSIYMYWVYLTQYGGTGNALLS
693|gene|hut        MLLEALLVSVLVGAGVVALAPNRYAGKLAAVLSLVPLGGSLYLW----SAFDGASNALL-
647|gene|nrc1       MMIEALLGVTLLSALVVMLAPDRIAGKLAAGLSLLPVVGSVWMF----VQFDGSGNALLE
713|gene|hla        -MIEALIGVTFVAALLVLLAPNEWAGRLAFAFSLLPFAGSLYLW----SGFESAGNALT-
987|gene|hvo        MIIEALIAVTFLAALVTFVLPDRYAGKAAFALSLAPVVGSLYMW----QQYDASGNALL-
1647|gene|hwa       MIIELLIAFTFIAALTIFAVPNRVAGRLAAIASAIPILGSLWMW----AQYDATGNALL-
21380|gene|hbo      MIIEALIAVAFVAALVVFVAPDEYAGRLAAALSLLPVVGSLFMW----AQYDASGNALL-
                      :  *:   ::.:      *:  * . *   *  *   *::::      : .:.***  

2312|gene|nph       GGDIAYETATEWLQLGQYTVSYHVGLDGISLPLVVLSTVLTTLAILSAWTPIDERQSEFY
11456|gene|hma      PADIAFGQQIPWITLGELEVSYYVGLDGISMPLLALTTVLTTLAIVSAWTPIDERQSQFY
2037|gene|hhi       PADIAFGQQIPWITLGELEVSYYVGLDGISMPLLALTTVLTTLAIVSAWTPIDERQSQFY
693|gene|hut        GNDPAFETQFAWFDLGPYALQWHVGLDGVSLPLLVLTTILTTAAIVSAWTPIDERESQFY
647|gene|nrc1       GGSLAFETMTHWITIGPYTLNWHVGIDGISMPLVVLSTVLTTLAITSAWTPIDERQSQFY
713|gene|hla        GGDIAYATQIEWLEVGGRTVSWFVGVDGISLPLVVLTTFLVPLAIVSAWTPIDARQSQFY
987|gene|hvo        GGNIAFETDIAWLQLGQYDIHWMVGVDGISMPLVVLTTVLTTLAIVSAWTPISERQSQFF
1647|gene|hwa       GGSIAYETDVIWLTLGGLELHWFVGVDGISLPLVVLTTILTMLAIVSAWTPIDERQSQFY
21380|gene|hbo      GGSIAFETDFVWLSLGNLDVHWFVGVDGISLPLIVLTTILTTLAIVSAWTPIDMRQSQFY
                      . *:     *: :*   : : **:**:*:**:.*:*.*.  ** ******. *:*:*:

2312|gene|nph       GLVLLLEGSLIGVFAALDFILWFVFWEAVLIPMYLLIGVWGGPRRKYAAIKFFVYTNIAS
11456|gene|hma      GLMLFMEVSLIGVFSALDFFLWFVFWEGVLIPMYLLIGVWGGPRRKYAAIKFFVYTNVAS
2037|gene|hhi       GLMLFMEVSLIGVFSALDFFLWFVFWEGVLIPMYLLIGVWGGPRRKYAAIKFFVYTNVAS
693|gene|hut        ALVLLLEAGLLGVFAALDFFLWFVFWEVVLVPMYFLIGIWGGPRRKYAAIKFFVYTNVAS
647|gene|nrc1       ALMLLMEASLLGVFTALDFFVWFVFWEFVLVPMYFLIGIWGGPRRKYAAIKFFVYTNVAS
713|gene|hla        GLMLFMEANLLGVFTALDFFLWFVFWEAVLVPMYFLIGIWGGPRRKYAAIKFFVYTNAAS
987|gene|hvo        GLMLLMEANLLGVFTALDFFVWFIFWEAVLLPMYFLIGVWGGPRRKYAAIKFFVYTNIAS
1647|gene|hwa       GLMLFMEANLLGVFTALDFFVWFIFWEAVLVPMYFLIGVWGGPNRRYAAIKFFVYTNIAS
21380|gene|hbo      GLMLFMEANLLGVFTALDFFVWFIFWEAVLVPMYFLIGIWGGPRRKYAAIKFFVYTNIAS
                    .*:*::* .*:***:****::**:*** **:***:***:****.*.*********** **

2312|gene|nph       LVMFIGYFALVFGLGDAVSSTGMPAVAQALR-ADQLGYLGTAAVGIGPDMLAMAAFLAMF
11456|gene|hma      LVMFAGLFALVFST--DLTSLSLPAMAEAFRTASGLPTIA----GVN---LMTISFILMF
2037|gene|hhi       LIMFAGLFALVFST--DLTSLSLPAMAEAFRTASGLPTIA----GVN---LMTISFILMF
693|gene|hut        LVMFIGFIALVFGLGDSVASLDLPVIAQTLQEEGALGSFA----GLEPDALKATAFLAMF
647|gene|nrc1       LLMFIGFMALVFGL--DVTTMDMPAIAQAIH-AGQFGTTY----GLGAETLKTVAFFAMF
713|gene|hla        LLMFIGFMSLTFALGDSVSSFALPEITQAIA-DGGLGTWF----GISPDRIAMIAFLAMF
987|gene|hvo        LVMFIGFISLVFGLGDSISSFRLPEIAQALQ-AGQLGSFA----GLSAGALASVAFVAMF
1647|gene|hwa       LAMFIGFIALVFGLGSSVSSMRLPEITQALR-AGSLTAFG----GIDAATLKLVAFIAMF
21380|gene|hbo      LVMFIGFIALVFGLGDSVSSMRLPEIAMALR-ANELGGFA----GLNAETLKLVAFVAMF
                    * ** * ::*.*.    :::  :* :: ::   . :        *:    :   :*. **

2312|gene|nph       VGFAVKVPVVPFHTWLPDAHVEAPTPVSVLLAGVLLKMGTYALLRFNFTMLPDQVETFAV
11456|gene|hma      FGFAVKVPVFPLHTWLPDAHVEAPTPVSVMLAGVLLKMGTYALLRFNFTMLADTARQLAV
2037|gene|hhi       FGFAVKVPVFPLHTWLPDAHVEAPTPVSVMLAGVLLKMGTYALLRFNFTMLADTARQLAV
693|gene|hut        AGFAVKVPIVPVHTWLPDAHVEAPTPVSVLLAGVLLKMGTYALLRFNFTMLPDVAAANAT
647|gene|nrc1       IGFAVKVPTVPLHTWLPDAHVQAPTPASVMLAGVLLKMGTYALLRFNFTMMPGIAQQYAV
713|gene|hla        LGFAVKVPIVPFHTWLPDAHVEAPTPVSVLLAGVLLKMGTYALLRFNFTMLPEQASALAV
987|gene|hvo        FGFAVKVPVAPLHTWLPDAHVEAPTPVSVMLAGVLLKMGTYALLRFNFTMLPETARAFAL
1647|gene|hwa       VGFAVKVPVAPLHTWLPDAHVEAPTPVSVMLAGVLLKMGTYALLRYNFTMMPDVAIDLVI
21380|gene|hbo      FGFAVKVPVAPLHTWLPDAHVEAPTPASVMLAGVLLKMGTYALLRFNFTMMPDVAKALVV
                     *******  *.*********:****.**:***************:****:.  .   . 

2312|gene|nph       PIALIAIISILYGALLALAQKDLKRIVAYSSVSSMGYVILGLVAYTVYGVGGATFQMIAH
11456|gene|hma      PLAIIGVVSVIYGAMLALAQRDLKRIVAYSSISSMGYVILGLVAFTPYGMGGATFQMIAH
2037|gene|hhi       PLAIIGVVSVIYGAMLALAQRDLKRIVAYSSISSMGYVILGLVAFTPYGMGGATFQMIAH
693|gene|hut        IIGIFAVVSVIYGAMLALAQRDLKRIVAYSSISSMGYVLLGLIAYTVHGVGGATFQMVSH
647|gene|nrc1       PIAALAVLSVIYGAMLALAQRDLKRIVAYSSVSSMGYVILGLVAYNYYGVGGATFQMVAH
713|gene|hla        PIAAIAVISVIYGAMLALGQKDLKRIVAYSSVSSMGYVILGLIVFTEYGVGGATFQMVAH
987|gene|hvo        PIALLAVASVIYGALLALAQQDLKRIVAYSSVSSMGYVILGLIAYTTYGVGGATFQMVAH
1647|gene|hwa       PIASIAVISVIYGALLALAQQDLKRIIAYSSVSSMGYVILGLIAYTTYGVGGATFQMVAH
21380|gene|hbo      PIAAIAVISVIYGAILALAQQDLKRIVAYSSVSSMGYVILGLVAYTTYGVGGATFQMIAH
                     :. :.: *::***:***.*.*****:****:******:***:.:. :*:*******::*

2312|gene|nph       GLISGLLFMTVGVFYNATHTRMVGDMGGLADRMPVTAGIFIAGAFGYMGLPLMAGFMAEL
11456|gene|hma      GLISGLMFMCVGVIYNTTHTRMVGDMSGLADRMPWTVGIFVAAAFGYMGLPLMAGFAGEY
2037|gene|hhi       GLISGLMFMCVGVIYNTTHTRMVGDMSGLADRMPWTVGIFVAAAFGYMGLPLMAGFAGEY
693|gene|hut        GFISGLMFMVVGVVYNQTHTRMVGDMSGLADRLPVTAGIFVAAAFGYMGLPLMSGFIGEA
647|gene|nrc1       GLISGLMFMCVGVIYNTAHTRMVGDLSGIADKMPVTAAVFIAAAFGYMGLPLMAGFAGEL
713|gene|hla        GLISGLMFMAVGVIYNATHTRMVGDMSGMADRMPVAVGILVAGAFGYMGLPLMAGFAGEF
987|gene|hvo        GLISGLMFMAVGVIYNTTHTRMVSDMSGIADRMPVTAGIFVAGAFGYMGLPLMAGFAAEF
1647|gene|hwa       GLISGLMFMSVGVIYNITHTRMVGDMSGIADRMPVTAGIFIAGAFGYMGLPLMAGFAGEF
21380|gene|hbo      GLISGLMFMVVGVIYNTTHTRMVGDMSGMADRMPVASGIFVAGAFGYMGLPLMAGFAGEF
                    *:****:** ***.** :*****.*:.*:**.:* : .:::*.**********:** .* 

2312|gene|nph       FVFIGAFQSAIL-PYAPVITAAGMFGIVVVAGYLLWAMQRSLFGPFRLETDYELERAPVH
11456|gene|hma      FIFQGSFNAPTLGGAAPVLTSLAMFGIVIVAGYLLWAMQRTLFGGFNLETDYEVSPAAFH
2037|gene|hhi       FIFQGSFNAPTLGGAAPVLTSLAMFGIVIVAGYLLWAMQRTLFGAFSLETDYEVSPAAFH
693|gene|hut        LIFIGAFPSDVL-PGAPLFTASAMFGIVIVAGYLLFAMQRALFGPFDLATDYELSRAPVQ
647|gene|nrc1       FIFLGGFGADF--AHAQLFTALAMFGIVIVAGYLLFAMQRVLFGPFAAETDYDIVPAALH
713|gene|hla        FIFVGSFAAPAL-PYAPIFTALAMFGIVIVAGYLLSAMQSTLFGPFELETDYDVGPAPFH
987|gene|hvo        FIFKGAFESTVM-EAMPLFTGAAMFGIVIVAGYLLFAMQRTLFGPFRFDGDYDITEAPFH
1647|gene|hwa       FIFKGAFASTVH-TAMPLFTAAAMFGIVIVAGYLLFAMQRTLFGPFSFDGEYEITTAAMH
21380|gene|hbo      FIFQGAFASTVH-SAMPLFTAAAMFGIVIVAGYLLFAMQRTLFGPFRFDGDYEITKAPIQ
                    ::* *.* :        ::*. .*****:****** ***  *** *    :*::  *..:

2312|gene|nph       DIVPLLTLVALIIALGVAPDLIFEMIRDATHSVIDYD----------FGGDL
11456|gene|hma      DVAPLAVLLLLVIALGVAPDLSFGMIQDSISPVLDIG----------GGA--
2037|gene|hhi       DVAPLAVLLLLVIALGVAPDLSFAMIQDSISPVLEIG----------GGA--
693|gene|hut        DVAPLLVLLACVIILGIHPDLFYGMIQDAVAPIVELG----------GGV--
647|gene|nrc1       DTVPIVALLLLVIVAGTVPNVFYGMIQDAVTPVVDAAASASAVVVSTGGVFL
713|gene|hla        DVAPLAVLLVAIIVLGVAPDIFFEMIRDAAVPVVE-G----------VTVDG
987|gene|hvo        DVAPLAVLLLLTIVLGVSPDIFFTMIQDAVNPILELG----------GAF--
1647|gene|hwa       DIAPLAVLLALVIALGVAPDLFFGMIQEAVTPILT-G----------GGV--
21380|gene|hbo      DIAPLAVLLLLVIILGVEPDLFFQMIQQAVNPILETG----------GGV--
                    * .*: .*:   *  *  *:: : **.::  .::