HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0376COG1204KOG0952 KOG0951arCOG00553Superfamily II helicasepre-mRNA splicing helicase

HOG Organism Gene ID Name Annotation
cHOG0376 nrc1 VNG2213 brr2 pre-mRNA splicing helicase
cHOG0376 hmu HMUK0671 Hmuk_0671 DEAD/DEAH box helicase domain protein
cHOG0376 hma RRNAC2961 brr2 Pre-mRNA splicing helicase
cHOG0376 hwa HQ1046A mer3 ATP-dependent DNA helicase
cHOG0376 hla HLAC2508 Hlac_2508 DEAD/DEAH box helicase domain protein
cHOG0376 hbo HBOR03020 Hbor_03020 superfamily II helicase
cHOG0376 hut HUTA1659 Huta_1659 DEAD/DEAH box helicase domain protein
cHOG0376 hvo HVO_2955 HVO_2955 brr Pre-mRNA splicing helicase
cHOG0376 nph NP0564A mer3_2 ATP-dependent DNA helicase 2
cHOG0376 hhi 220 brr2 pre-mRNA splicing helicase
MUSCLE (3.6) multiple sequence alignment


2213|gene|nrc1      ----------------------------------MDVAEVVPEFAEAFPFDEFNAMQREA
564|gene|nph        ---------------MSLPPPASFVASRTEYEPGTPVEAVFPSFAEAFPFESFNRMQSAA
1659|gene|hut       ------------------------MAEPVESPKAVPVADVLPDFAPAFPFESFNAMQAET
12961|gene|hma      MHPLFTYVRSPIETPLPSRNRDCDVSSRTDSEPTVAVAEVLPEFADAFPFEEFNRMQSAA
220|gene|hhi        ----------------------------------MAVAEVLPEFADAFPFEEFNRMQSAA
2508|gene|hla       ----------------------------------MKVADAVPEFADAFGFEEFNRMQREA
1046|gene|hwa       ----------------------------------MKVADVVPEFADAFSFDEFNQMQQEA
3020|gene|hbo       ----------------------------------MKVESVVPEFADAFGFDEFNRMQREA
2955|gene|hvo       --------------VYDARLRLVPDASAHPEVRPVKVAEAVPEFADAFGFEEFNRMQREA
                                                        *  ..*.** ** *:.** **  :

2213|gene|nrc1      VPALLESDANVVASAPTGSGKTALAELAICQTLADGGTALFVAPLRALTNEKEDEWERFE
564|gene|nph        LPAIADRDDNVVVSAPTASGKTALAEAAICRTLDAGGTALFLAPLRALTNEKESEWERFE
1659|gene|hut       LPALLERDENVVVSAPTASGKTAVAEVAIAKTIDRGGTALFLAPLRALTNEKESEWDRFE
12961|gene|hma      LPALLNRDDNVVVSAPTASGKTALAELAICKTLAEDGTALFLAPLRALTNEKESEWERFE
220|gene|hhi        LPALLNRDDNVVVSAPTASGKTALAELAICKTLAEDGTALFLAPLRALTNEKESEWERFE
2508|gene|hla       LPGILETDHNVVASAPTASGKTALAELAICKTLSESGTALFIAPLRALTNEKESEWERFE
1046|gene|hwa       APGILQTESNVVVAAPTASGKTALAELAICRALRHNGTALFIAPLRALTNEKESEWDRFE
3020|gene|hbo       APAILERDENVVAAAPTASGKTALAELAICRALRNDGTALFIAPLRALTNEKESEWERFE
2955|gene|hvo       LPAILDTDHNVVASAPTASGKTALAELAICRTLRDEGTALFIAPLRALTTEKETEWERFE
                     *.: : : ***.:***.*****:** **..::   *****:*******.*** **:***

2213|gene|nrc1      ALGYSVYVVTGERDLNPRRAERADVLVMTPEKADSATRKHDSPRYAFVTDVECVVIDEVH
564|gene|nph        SLGYSVYVVTGERDLDPRRAERADILVMTPEKADSATRKHDSPRYAFITDIDCCVIDEVH
1659|gene|hut       ELGYSVYVVTGERDLNPRRAERADVLVMTPEKADSATRKHDSSRYSFVTDVDCVVIDEVH
12961|gene|hma      EMGYSVYVVTGERDLNPRRAERADILVMTPEKADSATRKHETSRYSFITDVDCCVIDEVH
220|gene|hhi        EMGYSVYVVTGERDLNPRRAERADILVMTPEKADSATRKHETSRYSFITDVDCCVIDEVH
2508|gene|hla       DLGYSVYVVSGERDLNPRRAERADVLVTTPEKADSATRKHDSGRYSFITDVDCVVIDEVH
1046|gene|hwa       SLGYSVYVVTGERELNTRRAERADILVMTPEKTDSATRKHDSARYSFITDIDCCVIDEVH
3020|gene|hbo       ELGYSVYVVTGERDLNPRRAERADILVMTPEKTDSATRKHESARYSFITDVDCCVIDEVH
2955|gene|hvo       DLGYSVYVVTGERDLNPRRAARADILVMTPEKTDSATRKHDSARYSFIEDVDCVVIDEVH
                     :*******:***:*:.*** ***:** ****:*******:: **:*: *::* ******

2213|gene|nrc1      LLDSETRGSVLEVVVSRLRRLCDPRVVALSATMPNIGDVADWLDATPDTTFEFDDDYRPV
564|gene|nph        LLDSDRRGAVLEVTVSRLRRLCDPRVVALSATMQNVDDVAAWLDAPPESTFEFGDDYRPV
1659|gene|hut       LLDADRRGSVLEVTISRLRRLCDPRIVALSATMTNIGDVAEWLEAPAETTFAFGDDYRPV
12961|gene|hma      LLDSDRRGAVLEVTVSRLRRLCDPRVVALSATMPNIDDVADWLDAPDETTFAFGEKYRPV
220|gene|hhi        LLDSDRRGAVLEVTVSRLRRLCDPRVVALSATMPNIDDVADWLDAPDETTFAFGEKYRPV
2508|gene|hla       LLDSEKRGAVLEVTVSRLRRLQDPRVVALSATMPNIADVAEWLDAPAETTYEFGDEYRPV
1046|gene|hwa       LLDSDRRGGVLEVTVSRLRRLCDPRIVALSATMSNVDDVAGWLDASSETTFQFGEDYRPV
3020|gene|hbo       LLDSDTRGGVLEVTVSRLRRICDPRVVALSATMPNVEDVANWLDAPPETTFEFGDDYRPV
2955|gene|hvo       LLDSETRGGVLEVTVSRMRRICDPRIVALSATMPNIDDVAAWLDAPDETTFEFGDDYRPV
                    ***:: **.****.:**:**: ***:******* *: *** **:*. ::*: *.:.****

2213|gene|nrc1      DLHAGVRTYDHGDNPFADKYRRLFTALDLAEPHLREDGQSLVFVASRQDTVQAAKKTRDE
564|gene|nph        PLSATVETYAHGDNAFADKYRRLYRALDLAEPHINEGGQALVFVASRQDTVRAAEKARDE
1659|gene|hut       PLNADVKTYSHGENAFADKYRRLYRALDLVEPHLREDGQSLVFVSSRQDTVQAAKKTRDE
12961|gene|hma      PLNADVKTYSHGENAFADKYRRLYRALDLAEPHIREEGQALVFVSSRQDTVQAAKKARDE
220|gene|hhi        PLNADVKTYSHGENAFADKYRRLYRALDLAEPHIREEGQALVFVSSRQDTVQAAKKARDE
2508|gene|hla       DLETGVKTYSHGSNAFADKYRRLYRALDLAEPHVREDGQALVFVSSRQDTVQAAKKARDE
1046|gene|hwa       ELHTGIQLYTHGDNTFADKYRRLYRALDCAEEHLRDGGQALVFVSSRQDAVRAAGKARDE
3020|gene|hbo       DLHAGVKTYSHGENSFADKYRRLYRAIDLSEQHIRDGGQALVFVSSRQDTVRAAGKARDE
2955|gene|hvo       DLHAGVKTYTHGENSFADKYRRLYRAFDLAEPHIRDGGQSLVFVSSRQDAVRAAAKARDE
                     * : :  * **.*.********: *:*  * *:.: **:****:****:*.** *:***

2213|gene|nrc1      IAQRDIPVGSRGDYDFHTATEALDNETLRKSVLDGVAFHHAGLSTTDKSHVEQWFREGKI
564|gene|nph        LAERDIDIGARGDYDFHTDAAELENDTLRKSVVDGVGFHHAGLSKADKDRVEEWFKQGKI
1659|gene|hut       LAERDIPIGARGDYDFHNDASELNNNTLRQSVLDGVGFHHAGLSREDKNLVEQWFREGKL
12961|gene|hma      IVERDIPMGARGDYDFHNDAADLSNDTLRQSVLDGVGFHHAGLAREDKNRVEQWFKEGKI
220|gene|hhi        IVERDIPMGARGDYDFHNDAADLSNDTLRQSVLDGVGFHHAGLAREDKNKVEQWFKQGKI
2508|gene|hla       ITERDIPIDSRGDYDFHNEAKELTNDTLRQSVTDGVGFHHAGLGKEDRDRVEEWFKQGKI
1046|gene|hwa       IAQRDIPMGARGEYEFHTSAKELENDALSKAAPDGVGFHHAGLAKDDRDRVESWFKSGEI
3020|gene|hbo       LGKRDIPIGARGDYDFHNEAKELSNDSLRKAVPDGVGFHHAGLAKDDRDKVEAWFKEGKI
2955|gene|hvo       LAKRDVPIGARGDYDFHNEAKELSNDSLAKGVLDGVGFHHAGLSRDDREAVEEWFKEGKI
                    : :**: :.:**:*:**. :  * *::* :.. ***.******.  *.. ** **..*::

2213|gene|nrc1      RVLFSTSTLAWGVNLPARCVVIRDTKLHDPLEGEVDMSPLDVLQMLGRAGRPGYDDVGYG
564|gene|nph        QLLFSTSTLAWGVNLPARCVVIRDTKLHDPLEGEVDISPLDILQMLGRAGRPGYDDAGYA
1659|gene|hut       AILFSTSTLAWGVNLPARCVVIRDTKLHDPLEGEVDMSPLDVLQMLGRAGRPGYDEHGYA
12961|gene|hma      QLLFSTSTLAWGVNLPARCVVIRDTKLHDPLEGEVDMSPLDVLQMLGRAGRPGYDDMGYA
220|gene|hhi        QLLFSTSTLAWGVNLPARCVVIRDTKLHDPLEGEVDMSPLDVLQMLGRAGRPGYDDMGYA
2508|gene|hla       KLLFSTSTLAWGVNLPARCVVIRDTKYHDPLEGETDISPLDVLQMLGRAGRPGYDDVGYG
1046|gene|hwa       QLLFSTSTLAWGVNLPARCVVIRDTKYHDPLEGEVDISPLDVLQMLGRAGRPSYDDVGYG
3020|gene|hbo       QLLFSTSTLAWGVNLPARCVVIRDTKYHDPLEGEVDISPLDILQMLGRAGRPGYDDVGYG
2955|gene|hvo       QLLFSTSTLAWGVNLPARCVVIRDTKHHDPLEGEVDISPLDILQMLGRAGRPGYDDVGYG
                     :************************ *******.*:****:**********.**: **.

2213|gene|nrc1      WVVCDTSDADTYRTLLDEGHEIESRLDGNLAEHLNAEIAMGTIRDLGDVMAWLETTFYYQ
564|gene|nph        HIVCDGSDADKYRQLLRDGKPIESRLAETLDSHLNAEIALGVVDDIDDVLSWLETTFYYA
1659|gene|hut       WVITDRSEADKYRRLLRDGKEIESRLAESLDAHLNAEIAMGTIRDLDDVLDWLETTFYYV
12961|gene|hma      WVVCDRSDADKYRRLLRDGKEIESRLAAELDAHLNAEIALGTIDDVDDVMDWLATTFYYA
220|gene|hhi        WVVCDRSDADKYRRLLRDGKEIESRLAAELDAHLNAEIALGTIDDVDDVMDWLSTTFYYA
2508|gene|hla       WVVCDRADADKYRALLREGKEIESRLAAELESHLNAEIAMGTIRGLEDVMEWLETTFYYV
1046|gene|hwa       WVVCDRSEAEKYRRLLAEGKEIESRLAEDLDSHLNAEIAMGTIKDLDDVLTWLETTFYYR
3020|gene|hbo       WVVCDRSDADKYRRLLREGKEIESRLAEDLDSHLNAEIAMGTIGDLEDVMSWLQTTFYYQ
2955|gene|hvo       WVVCDRSDQNKYRRLLREGKEIESRLAEDLDSHLNAEIAMGTIRDLDDVMSWLETTFYYR
                    .:: * :: :.** ** :*: *****   *  *******:*.: .: **: ** ***** 

2213|gene|nrc1      RAQSAPDAYEFST-LRDRVRATLDDLIDQGFVETDADLGLSATRLGVLASTYYLRLDTAR
564|gene|nph        RAQSAPGKYEAGDSLRDRVSATLERLVDGGFVD-QSGLNIEPTGLGRLTSQFYLQLNTAE
1659|gene|hut       RANNAPDRYDAAGSLREQASSTMRGLVDRGFVEMDDDLRVSATALGRLASRFYLRLDTAR
12961|gene|hma      RSQSAPDKYDAGSDLRNRVSDTLSALVDEGFVE-QEGLNVEPTRLGQLASKFYLRLSTAR
220|gene|hhi        RSQSAPNEYDAGSDLRNRVSDTLSALVDEGFVE-QDGLNVEPTRLGQLASKFYLRLSTAR
2508|gene|hla       RAESKPDEYEFAT-LRDRVRDTLESLVDDGFVAADDDLAIEPTGLGRLASKYYLRLDTAR
1046|gene|hwa       RAESNPDAYDFDT-LKERMRSTLESLVNRGFVEMDDDLSVSGTTLGRLTSKYYLRLSTAE
3020|gene|hbo       RARSKPNEYDFDG-LRERVRETLESLVARGFVEMESDLSIEATRLGRLASKYYLRLDTAR
2955|gene|hvo       RAQSNPAAYDFED-LRSRVRDVLDRLVSRGFVEMDDDLSIDATPLGRLTSKYYLRLGTAS
                    *: . *  *:    *...   .:  *:  ***  : .* :. * ** *:* :**.*.** 

2213|gene|nrc1      EFRAVIDD-----------AADDRAILRAVAAAGEFDSVSARHSEQDAIHTVLGHSG---
564|gene|nph        SFDALCQRAASNESP----PIDESTVLRAVADAAAFDSVSARRDEREAFEAVLGHEG---
1659|gene|hut       HFGDLADAAGER-------ELSERDILSAVAGAGEFDSVSARTDERDAVRAVLGDDRTDQ
12961|gene|hma      RFADVAERCQDAADPDSAVSVDADDLLTAVAGATEFDSVSARSDEEDAVHAVLGDS----
220|gene|hhi        RFADVAERCQDAADPDSAVSVDADDLLTAVAGATEFDSVSARSDEEDAVHAVLGDS----
2508|gene|hla       RFRRLADHE----------TLTVDSVLETVASAGEFDSVSARSAESDAIDRILD--G---
1046|gene|hwa       RFDSLCDRG----------TLTATGILETVAGAGEFHAVSARQSESDAIDKVLSDAS---
3020|gene|hbo       RFASLCDRD----------TITDESILETVAGAAEFHDVSARQSEMDAVDSVLT--G---
2955|gene|hvo       RFADLAERD----------RITADDVLETVAGAADFRQVSARQSEVDAVDSVLT--G---
                     *  : :                  :* :** *  *  ****  * :*.  :*       

2213|gene|nrc1      -----DEMADGSRKVYAILRASMRGAVPSELRSDAWVITQNALRLLAALGAFFDRYDDPM
564|gene|nph        -----DDLDDGNRKVLAILRAGMDGTTPGELQSDAWVIRRNARRLLAALRAFCERFADPR
1659|gene|hut       ETVVDVDLDSGQRKVLAILEASMRGTTPSELQSDAWVIRQNANRLLAALQAFLAEFDGAR
12961|gene|hma      ---VDDSLDAGQRKVLAILRSGMTGTTPTELKSDAWVIRQNALRLLAAMREFVDTLGPAR
220|gene|hhi        ---VDDSLDAGQRKVLAILRSGMTGTTPTELKSDAWVIRQNALRLLAAMREFVDTLGPAR
2508|gene|hla       ---RDTDLEDGHRKVFAILLAGMADSIPSDLRSDAWVIRQNALRLLAALSEFLDRFAGPR
1046|gene|hwa       ---ISTELEDGSKKVLAILYAGMNGATPADLRSDAWIIRQNARRLLSALREFLDSFAGPR
3020|gene|hbo       ---VDTTLEDGPRKVLAILYAGMSNSTPSDLRSDAWVIRQNGLRLLSALREFVDAFAGPR
2955|gene|hvo       ---VSTTLEDGPKKVLAILHASMANSTPSELRSDAWVIKQNALRLLSALREFLDTFADAR
                           :  * .** *** :.* .: * :*.****:* .*. ***:*:  *      . 

2213|gene|nrc1      GANAAARLEARIDTGVPEAAVGLTAIEGVAAGRAHKLHDEGIDTPGDVRDAGVSGLVDAG
564|gene|nph        DANLVRRIEARIEHGVSDDTVGLVAIEGVGTGRAQTLAEAGIDSPAAVRAAGVDGLRKAG
1659|gene|hut       AANLARRIEARVEHGISDDAVGLTAIDGIGSGRASKLAAEGLATPADVVAAGVEGLVDAG
12961|gene|hma      YANLACRVEARVEHGISADAVGLTAIDGVASGRAGKLAAAGLTSPADVVEAGEDGLVRAG
220|gene|hhi        YANLACRVEARVEHGISADAVGLTAIDGVGSGRAGKLAAAGLTSPADVVEAGEDGLVRAG
2508|gene|hla       AANLACRVEARVEHGVSREAVALTAIDGVGSGRAERLADAGLTSPAAVVDAGAGALENAG
1046|gene|hwa       AANLARRVAARVEHGVSRDAVALTAIDGIGATRANKLATGGLHSPADIIDAGVTELQRAG
3020|gene|hbo       AANLARRVEARVEHGVSRDAVALTAVDGIGPNRASKLATGGLRSPRDVVEAGTAELTQAG
2955|gene|hvo       AANLAKRVEARVDNGVSSDAAALTAVDGIGPGRARKLATGGLSTPADVVDAGVKELTRAG
                     ** . *: **:: *:.  :..*.*::*:.. **  *   *: :*  :  **   *  **

2213|gene|nrc1      LAPGVAESVHEQAAGLPAVAVDWGDFPDSVPAGDNDLREVTVRNHGGGANAGVTVT----
564|gene|nph        LSESVAERIHEQARDLPALDFDWKDIPDRIRHGENTMGEVTIKNAGGGEPAGIRVT----
1659|gene|hut       LSEGVAERVLESARDLPVVEIDWGDFPESIPHGENEMCEVTVRNTVGGGQAGIRVT----
12961|gene|hma      LSDGVAEQVLANARDLPVVSIDWGDFPETIAPGDNDMREVTVENTGGSARAGLRVT----
220|gene|hhi        LSDGVAEQVLANARELPVISIDWGDFPGTIAPGDNDMREVTVRNTGGSARAGLRVT----
2508|gene|hla       MSGSVAERIVDAARDCPRIDVDWGDFPDAIAVGENEMCEVAVSTVSGSARTGIRVT----
1046|gene|hwa       LAEGVAKQIVTNAREFPDIDVRWESLPDEITRGANEICEVTIRNVGGSGYVGIRIT----
3020|gene|hbo       LSDGVAKQVVQNARNFPDIDIAWGDFPDCIGTGENQMCEVRVRNRAGGATVGIRVTAVAG
2955|gene|hvo       LSQGVAERVIESAKDLPAPDIDWGEFPESVARGESDMHDIRVRNDGGGGSVGVRVT----
                    :: .**: :   *   *   . * .:*  :  * . : :: : .  *.  .*: :*    

2213|gene|nrc1      ---VNGVEMTTETSYLDGALSVPVGMFGAPDADTLTFEVTVAFAELPLPPVTETRTVDVV
564|gene|nph        ---VNGVEMTQQTSYL-GEATVPVGVFGGDA-ETLTYEVEVAFPNLPLRPVVDSRTVDVA
1659|gene|hut       ---VNSVEMTASETYL-GEATLPVGVFGGDA-DELTFRVEVSFPELPIQPVVETRTVEVV
12961|gene|hma      ---VNGREMTAKPSYL-GQATLPVAVFGADA-DELTFTVEVAFPALPLPTITETRSVLVR
220|gene|hhi        ---VNGREMTAKPSYL-GEATLPVAVFGADA-DELTFTVEVAFPALPLPTITETRSVLVR
2508|gene|hla       ---VNDVEMTATTTYLDGETTVPVGVFGPPDADELEFVVEVVFPDLPLMPVKATRTVRVK
1046|gene|hwa       ---VNNIEMTATETYLDNTTTVPVGVFGADT-ERLKFTIEITFPAEPLHPVRAQRAVSVV
3020|gene|hbo       ETGADEAEMTTKRTYLSDETAVHVGVFGAPA-DEVTYRVEVTFPDDPLHPITETRTVRVS
2955|gene|hvo       ---VNDVEMSTKTCYLSDEVTVPVGVFGAAD-DELEFVVEVAFPDLPLLPIRESRTVRVE
                       .:  **:    ** .  :: *.:**    : : : : : *.  *: .:   *:* * 

2213|gene|nrc1      ---
564|gene|nph        ---
1659|gene|hut       ---
12961|gene|hma      ---
220|gene|hhi        ---
2508|gene|hla       ---
1046|gene|hwa       DNE
3020|gene|hbo       ---
2955|gene|hvo       ---