HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0375COG2102KOG2316arCOG00035Predicted ATPases of PP-loop superfamilyconserved motif SGGKD at the N terminus

HOG Organism Gene ID Name Annotation
cHOG0375 nrc1 VNG0391 pla conserved motif SGGKD at the N terminus
cHOG0375 hmu HMUK2825 Hmuk_2825 ATP binding protein
cHOG0375 hma RRNAC0632 hypothetical protein
cHOG0375 hwa HQ1669A hypothetical protein
cHOG0375 hla HLAC0801 Hlac_801 ATP binding protein
cHOG0375 hbo HBOR22660 Hbor_22660 PP-loop superfamily ATP-utilizing enzyme
cHOG0375 hut HUTA2709 Huta_2709 ATP binding protein
cHOG0375 hvo HVO_1077 HVO_1077 conserved protein
cHOG0375 nph NP0382A hypothetical protein
cHOG0375 hhi 1290 HAH_1290 ATP binding protein
MUSCLE (3.6) multiple sequence alignment


1669|hp|hwa         MNISADNQPQQTSNHWVSLFSGGKDSSWALYRALEDGRDVTHLLTVHPSADSYMYHVPET
801|gene|hla        ---MTD--D------WVSLFSGGKDSSWALYRALEEGLDVSRLLTVHPAGDSYMYHTPAT
22660|gene|hbo      ---MTESGD------WVGLFSGGKDSSWAVYRALEAGLDVTRLLTVHPGDDSYMYHVPAT
391|chp|nrc1        ---MTD-GQ------WVGLFSGGKDSSWALYRALEAGLDVGRLVTVHPESDSYMYHVPAT
2709|gene|hut       MTDTAD-SA------WVSLFSGGKDSSWALYRALEDGLPVERLVTVHPAGDSYMYHVPAT
382|hp|nph          -----M-KP------WVSLFSGGKDSSWALYRALEDGKPVERLVTVHPEGDSFMYHVPAT
10632|hp|hma        ---MTD-GA------WVSLFSGGKDSSWALYRALERGHPVERLVTVHPEGDSYMYHVPAT
1290|gene|hhi       ---MTD-GA------WVSLFSGGKDSSWALYRALERGHPVEHLVTVHPEGDSYMYHVPAT
                                   **.***********:***** *  * .*:****  **:***.* *

1669|hp|hwa         KLAQLAAKSAGIELIEINPDEF--DASNAVDAGTQGDRELEPLENAVEALDKTLTGGITG
801|gene|hla        ELAALAAESVGIDLVEVSPADF--GADDVDDAGEQGDAELEPMEAALREIAAGDDVDLAG
22660|gene|hbo      HLAALAAESLGIELIEVTPDDL--GAAEATDSSEQGDAELEPLEAALEALAAEID--LAG
391|chp|nrc1        RLAELAAESIGIPVVNVTPDAF--ETADVADAGAQGDTELEPLEDAVTDVADTLDDGLAG
2709|gene|hut       DLARLAAESIDIPLLEIEPDDF--GAGDVRDAGVQGDRELEPLEGALAELDDELDGGVAG
382|hp|nph          ELASLAAESIGIPLVNVRPDDFDDGATAAEDSSQRGDRELEPLEAELSALADEL-GGIDG
10632|hp|hma        RLARLAAESIGIQLVEIEPDDF--EADDVPDSGEQGDAELEPLEAALHELDTELDGGISG
1290|gene|hhi       RLARLAAESIGIPLVEIEPDDF--EADDVLDSGDQGDAELEPLEAALRELDAELDGGITG
                     ** ***:* .* :::: *  :   :  . *:. .** ****:*  :  :       : *

1669|hp|hwa         VTAGAVESEFQTDRIRGMCNRLDIELFAPLWQRDPITLAENMIAAGFEITIIQVAARGLD
801|gene|hla        VTAGAVESEFQTSRIQGMCDRLGIDLFAPLWQESPVALAEAMFEAGFEIRIVQVAAYGLD
22660|gene|hbo      VTAGAVESEYQTNRIQGMCDRLEIDLFAPLWQEDPRELGEAMIDAGFEIQIIQVAAHGLD
391|chp|nrc1        VIAGAVESDFQTSRMEGMCDRLGCELYAPLWQQPPRELADAMLTAGFEIRIIQVAAYGLD
2709|gene|hut       LVAGAVESEFQTSRIEGLSDRLDAELFAPLWQRDPVDLAESMLDAGFEIRIVSVSAAGLD
382|hp|nph          VTAGAVESSYQTDRLEGLCDRLDAELFAPLWQQNPRELAEAMFAAGFEITIVSVSARGLD
10632|hp|hma        VTAGAVESEYQTTRIESMADRLEANVFAPLWQENPRDLADAMLDAGFEIQIIRVAAYGLD
1290|gene|hhi       VTAGAVESEYQTTRIESMADRLEANVFAPLWQENPRDLADAMLDAGFEIRIIRVAAYGLD
                    : ******.:** *: .:.:**  :::*****  *  *.: *: ***** *: *:* ***

1669|hp|hwa         SSWLGRTLDTETLSELITLNDRHGVHVLGEGGEFETFVTNGPHLSRPIELEYTTIWEGTR
801|gene|hla        ESWLGRRYDADALAELVDLREECGVHPLGEGGEFETYVVDGPHMDRRIDMEYDTVWEGDR
22660|gene|hbo      ESWLGRTLDHDALEELVELNEQYGVHPLGEGGEFETFVTDGPHMSNPIELEYETVWEGTR
391|chp|nrc1        KSWLGRRLDRDALAALAALNDEYGVHMLGEGGEFETLVTDAPHMDRPIRLDYETVWAGDR
2709|gene|hut       ETWLGRRLDADALADLRELNAEYGVHVLGEGGEFETLVTDGPHMDRPIELDYVTDWDGTR
382|hp|nph          ESWLGRTLDAEALAELERLNDEYGVHVLGEGGEFETLVTDAPHMDRRIELEYETTFDGLR
10632|hp|hma        ESWLGRTLDADALDELEALNDEYGVHILGEGGEFETLVTDGPHMDRRIEIEYETEWDGSR
1290|gene|hhi       ESWLGRTLDADALDELEALNDEYGVHILGEGGEFETLVTDGPHMDRRIELEYETEWDGSR
                    .:****  * ::*  *  *.   *** ********* *.:.**:.. * ::* * : * *

1669|hp|hwa         GYIDVTNATLR-
801|gene|hla        GHVEIRDARLE-
22660|gene|hbo      GHLEITDARLGE
391|chp|nrc1        GHIEITEACLGP
2709|gene|hut       GSIRIEDAWLG-
382|hp|nph          GSLQITDAWLAA
10632|hp|hma        GTVQIEDAWLA-
1290|gene|hhi       GTLQIEDAWLA-
                    * : : :* *