HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0374COG0512KOG0026arCOG00086Anthranilate/para-aminobenzoate synthases component IIanthranilate synthase beta chain

HOG Organism Gene ID Name Annotation
cHOG0374 nrc1 VNG1646 trpG1 anthranilate synthase beta chain
cHOG0374 hmu HMUK1768 Hmuk_1768 glutamine amidotransferase of anthranilate synthase( EC:4.1.3.27 )
cHOG0374 hma RRNAC1517 trpG1 anthranilate synthase component II
cHOG0374 hwa HQ3166A trpG anthranilate synthase, component II
cHOG0374 hla HLAC1942 Hlac_1942 glutamine amidotransferase of anthranilate synthase
cHOG0374 hbo HBOR10760 Hbor_10760 anthranilate synthase, component II( EC:4.1.3.27 )
cHOG0374 hut HUTA1284 Huta_1284 glutamine amidotransferase of anthranilate synthase
cHOG0374 hvo HVO_2453 HVO_2453 trpG anthranilate synthase component II
cHOG0374 nph NP3344A trpG_1 anthranilate synthase, component II 1
cHOG0374 hhi 2088 trpG1 anthranilate synthase component II
MUSCLE (3.6) multiple sequence alignment


1646|gene|nrc1      ----------------MNVVVVDNYDSFTYNLVEYLSAQPRDDHAPDVTVLKNTASLAAV
3166|gene|hwa       --------------MTLSVLVIDNFDSFTYNLVEYLSEQRINNEPLDVHVRKNTASLKQI
10760|gene|hbo      --------------MTLRVVVVDNFDSFTYNLVEYLSEQRIGDDEIAVEVRKNTASLDEI
1942|gene|hla       ----------------MKVVVVDNFDSFTYNLVEYISDQPLDGEEIAVEVFKNTASLVEI
3344|gene|nph       ---------------MTRVVFIDNFDSFTYNLVEYVSQH----DGTETAVRRNTASLSEI
1284|gene|hut       MSESTSANATETPTDDLEVLFVDNFDSFTYNLVEYTSEY------ANTTVVKNTASLSDV
11517|gene|hma      MSTAQPAGA-DAVRDDLRVLFVDNFDSFTYNLVEYVSEH------AETEVVRNTASLDDV
2088|gene|hhi       MSTAQPAGA-DAVRDDLRVLFVDNFDSFTYNLVEYVSEH------AETEVVRNTASLDDV
                                      *:.:**:********** *          . * .*****  :

1646|gene|nrc1      RAADPDAVVISPGPGHPDTPRDVGVTTDVLRAVSPRVPTLGVCLGMEAAVHEYGGTVGRA
3166|gene|hwa       ETIDPDAIVISPGPGHPKNARDVGVTNDVLTTISQTVPTLGVCLGLEAAVYAYGGNVGRA
10760|gene|hbo      RDLDPDAIVISPGPGHPKNDRDVGVTTEVLTTLSKSIPTLGVCLGLEAAVYVYGGSVGHA
1942|gene|hla       RDADPDAILISPGPGHPKNERDVGVTMPVLRDLSPEIPTLGVCLGLEAAVYEYGGTVGHA
3344|gene|nph       EALDPDAIVISPGPGHPKNDRDVGVTMDVVSELSTEVPTLGVCLGLEAAVYAHGGTISRA
1284|gene|hut       RAADPDAIVISPGPGHPRNDRDVGVSTDVLREISPDVPTLGVCLGLEAAVYEYGGTVGHA
11517|gene|hma      EAFDPDAIILSPGPGHPKNERDVGVTLDVLREVSPDVPTLGVCLGLESAVYAYGGTIGRA
2088|gene|hhi       EVFDPDAIILSPGPGHPKNERDVGVTLDVLREVSPDVPTLGVCLGLESAVYAYGGTIGRA
                       ****:::******* . *****:  *:  :*  :********:*:**: :**.:..*

1646|gene|nrc1      AEPMHGKTTPVSHDETGIFADIQQDFPAARYHSLVCTSIPSCFAVTATT-----------
3166|gene|hwa       PAPVHGKSSTIAHDGYGIFDGLDKTFEAGRYHSLIATDVPECFEISAATRVSGTLSATDD
10760|gene|hbo      PEPIHGKAFPVEHDSHGVFAGLEQQFQAGRYHSLVATEVPECFEVSATT-----------
1942|gene|hla       PEPIHGKAFPVDHDGEGVFVGLDQGFRAGRYHSLAATEVSDDFSVTATT-----------
3344|gene|nph       PEPIHGKAFPVDHDGEGVYAGLEQGFRAGRYHSLVAESVPDCFAVTATT-----------
1284|gene|hut       PEPIHGKAASISHDGKGVFAGLDQGFQGGRYHSLVAGDVPDCFEVTATT-----------
11517|gene|hma      PEPIHGKAFPIDHDGKGVFAGLEQGFQGGRYHSLIADDVPEEFVVSATT-----------
2088|gene|hhi       PEPIHGKAFPIDHDEQGVFEGLEQGFQGGRYHSLIAEDVPEEFVVSATT-----------
                    . *:***: .: **  *:: .::: * ..***** . .:.. * ::*:*           

1646|gene|nrc1      -------------------RDG-SLPMAIRHRDHPLACVQFHPESVLTGVGHDVIGNFLD
3166|gene|hwa       SPQSITTREDPDTDADSNDDVDDDLIMGIRHREYPIEAVQFHPESVLTGVGHDLIKNFLN
10760|gene|hbo      ------------------DHFGDELVMGVRHREYPIEAVQFHPESVLTGVGHDVVRNFLQ
1942|gene|hla       ------------------DHEGEEIVMGIRHRDHPIEAVQFHPESVLTAVGHDLIRNFLA
3344|gene|nph       ------------------DHEGEELVMGVRHRAHPLECVQFHPESVLTGVGHDIIANFLD
1284|gene|hut       ------------------ETDDADLVMGIRHREHPIEAVQFHPESVLTAVGHDVIRNFLV
11517|gene|hma      -----------------ETEDGTELVMGVRHREHPIEAVQFHPESVLTAVGHDVIRNFLA
2088|gene|hhi       -----------------ETEDGTELVMGVRHREHPIEAVQFHPESVLTAVGHDVIRNFLA
                                         . .: *.:*** :*: .**********.****:: *** 

1646|gene|nrc1      AAAAH---------------------
3166|gene|hwa       RCGRVDDDNCDNSSDAQKKPTTTPSD
10760|gene|hbo      AVGNERAVASP---------------
1942|gene|hla       SV------------------------
3344|gene|nph       TVRGQ---------------------
1284|gene|hut       SV------------------------
11517|gene|hma      GL------------------------
2088|gene|hhi       GL------------------------