HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0373COG0527KOG0456arCOG00861Aspartokinasesaspartokinase II alpha subunit

HOG Organism Gene ID Name Annotation
cHOG0373 nrc1 VNG2374 lysC aspartokinase II alpha subunit
cHOG0373 hmu HMUK0758 Hmuk_0758 aspartate kinase( EC:2.7.2.4 )
cHOG0373 hma RRNAC2663 lysC aspartate kinase
cHOG0373 hwa HQ1005A lysC aspartate kinase
cHOG0373 hla HLAC2743 Hlac_2743 aspartate kinase
cHOG0373 hbo HBOR02150 Hbor_02150 aspartate kinase( EC:2.7.2.4 )
cHOG0373 hut HUTA1243 Huta_1243 aspartate kinase
cHOG0373 hvo HVO_0008 HVO_0008 lysC aspartokinase
cHOG0373 nph NP0550A lysC aspartate kinase
cHOG0373 hhi 3071 lysC aspartate kinase
cHOG0373 hhi 2505 HAH_2505 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2505|hp|hhi         -------------------------------------------MTMNE------------
1243|gene|hut       MRVVVKFGGTSLGSGDRIERAADSIAAVVEQGHEVAVVASAMGSTTDHLLDEIEYDADEA
12663|gene|hma      MRVVAKFGGTSLGSGDRINRAADSIAAAVQQGHEVAVVASAMGNTTDELLEEINYDADSA
3071|gene|hhi       MRVVAKFGGTSLGSGDRINRAADSIAAAVQQGHEVAVVASAMGNTTDELLDEINYDADSA
2374|gene|nrc1      VRVVTKFGGTSLGSGDRVERAADSIADAVAAGHEIAVVASAMGNTTDELLDDITFDADEP
550|gene|nph        MRVVAKFGGTSLGNGDRVNRAADSIAAAVEEGHEVAVVASAMGSTTDFLLDAIEFEADEA
2743|gene|hla       MRVVAKFGGTSLGSGDRIERAADSVANAVAAGHEIAVVASAMGSTTDDLLDDITFETDDA
1005|gene|hwa       MRIVTKFGGTSLGNGDRITRAADSIAAAIDAGHEIAVVASAMGSTTDYLLDEIHYDAADK
2150|gene|hbo       MRVVAKFGGTSLGSGDRINRAADSIAAAVEKGHEIAVVASAMGNTTDDLLDEIRFDADDR
                                                                * :             

2505|hp|hhi         --------GVHVTWKINREA--------------------ITNEDGEIDPGKRSGLKSEV
1243|gene|hut       DQAEIVSMGERTSVRMLKGALSARGIGADFLEPGSEDWPIITDEYGEVDVEETKKRAHAL
12663|gene|hma      DRAEIVSMGERTSVRMLKGALAARGIEAVFLEPGSEDWPIITDEYGEVDVEETQKRAHAL
3071|gene|hhi       DRAEIVSMGERTSVRMLKGALAARGIEAVFLEPGSEDWPIITDEYGEVDVEETQKRAHAL
2374|gene|nrc1      DRAEIVSMGERTSVRMLKAALAARGVDATFLEPGTTDWPIVTNERGEVDADATAAGVDRL
550|gene|nph        DEAEIVSMGERTSVRMLKAALGARDINAKFLEPGTEEWPVITDEHGEVDVEATQRRAKQL
2743|gene|hla       DRAEIVSMGERTSVRMLKAALSVRDVDAVFLEPGHPDWPVITNEVGEVDVEETKKRARKI
1005|gene|hwa       DRAEIVSMGERTSVRMLKGALSARGVTAQFLEPGSDDWPIITNERGEVDVGETQRRAADL
2150|gene|hbo       DRAEIVSMGERTSVRMLKAALAARGVNALFVEPGADQWPVIANDLGEVDVEETKHRAADL
                            * ..: .: . *                    :::: **:*          :

2505|hp|hhi         QEKF--DEDIETTLGVAEEAEPGTTIALCALVLGSIRTAIMVKEYLDSREE---TDKVEV
1243|gene|hut       AGQL--QDVVPVMTGFLAEDHSGDVTTLGRG--GSDTTAVMLGKYMDADEVVIVTDVEGV
12663|gene|hma      AGQL--KDVVPVITGFLAQDYQGNVTTLVRG--GSDTSAVMMGDYMDADEVVIVTDVEGV
3071|gene|hhi       AGQL--KDVVPVITGFLAEDYQGNVTTLGRG--GSDTSAVMMGDYMDADEVVIVTDVEGV
2374|gene|nrc1      AGRL--GDTVPVITGFLAEDPQGNVTTLGRG--GSDTTAVMLGRYLDADEVVIVTDVEGI
550|gene|nph        AADMAAEGYVPVITGFLAQDHAGNVTTLGRG--GSDTTAVMLGNYMNADEVVIITDVEGV
2743|gene|hla       AARM--DGVVPIITGFLAEDHDGNVTTLGRG--GSDTTAVMLGNYMDADEVVIVTDVEGV
1005|gene|hwa       ASNL--DDVVPVLTGFLAESHDGTTTTLGRG--GSDTTAVMLGHYTDADEVVIVTDVEGV
2150|gene|hbo       AADL--DNVVPVITGFLAENHDGEITTLGRG--GSDTTAVMLGRYMDADEVVIVTDVEGV
                       :     :    *.  :   *   :*     **  :*:*:  * :: *    **   :

2505|hp|hhi         TTADGSFVEVTGSNGETVV-----------EITSP-------------------------
1243|gene|hut       MTGDPRVVEGARNVGEISVDELRNLSFRGAEVVAPSALSYKDGNMDVRVVHYQHDDLLKG
12663|gene|hma      MTGDPRVVEGARNVGKISVDELRSLSFRGAEVVAPSALSYKSEDLGVRVVHYQHGDLLSG
3071|gene|hhi       MTGDPRVVEGARNVGKISVDELRSLSFRGAEVVAPSALSYKSDDLGVRVVHYQHGDLLSG
2374|gene|nrc1      MTGDPQVVEGARNVGRITVDELRNLSFRGAEVIAPSALSFKDDALDVRVIHYQHGDLLSG
550|gene|nph        MTGDPRVVEGARNVGEITVDELRNLSFRGAEVVAPSALSYKTADMIVRVAHYQHGDLLDG
2743|gene|hla       MTGDPRVVEGARNVGQITVDELRNLSFRGAEVVAPSALSYKDEDLAVRVVHYQHGDLLRG
1005|gene|hwa       MTGDPRVVEGARNVGQITVDELRNLSFRGAEVVAPSALTYKNDDLGVRVVHYQHGDLLTG
2150|gene|hbo       MTGDPHVVEGARNVGRITVDELRNLSFRGAEVVAPSALSYKDDNLAVRVVHYQHGNLLTG
                     *.*  .** : . *   *           *: :*                         

2505|hp|hhi         ------------------------------------------------------------
1243|gene|hut       GTSIEGEFQKLIDLQENKLCCLTAAGRSIRNQSGILAQLSNALSAEDINVEAVSSGMDSI
12663|gene|hma      GTSIEGEFQNLIDLQEQPIACVTVAGRAIRNSPGILADLSGAIADEDINIEANSSGMDSL
3071|gene|hhi       GTSIEGEFQNLIDLQEQPIACVTVAGRAIRNSPGILADLSGAIADEEINIEANSSGMDSL
2374|gene|nrc1      GTRIEGTFESMIDMRDSPLACLTVAGRAIRNRPGITSALSTALSDSDINVDAVASGMDSM
550|gene|nph        GTTIEGQFQNLIDMREEPLACLTAAGRAIRNTPGILSDLSTELSEADINVDAVASGMDSV
2743|gene|hla       GTRIEGEFESLIDMREEPLACLTIAGRAIRNRSGILSQLANALREEEINIDAVASGMDSV
1005|gene|hwa       GTLIEGEFENLIDMQEDMLACVTVAGRSIRNSTGILADLSQSLRDDGINIDAVASGMDSI
2150|gene|hbo       GTLIEGEFQNLIDMQEDPLACVTVAGRSIRNRPGILADLSQALREKGVNVDAVASGMDSI
                                                                                

2505|hp|hhi         -------------------------------DGDTEVVKV--------------------
1243|gene|hut       TFYLDTAVAESAEAILHDEVVDADVLSSITVIQDVAVIRVTGGELPDQPGAVKQVINPVS
12663|gene|hma      TFYVDEDDAEEAEALLHARIVDDETLSSVTVEDEIAVIRVTGGD-PSQSALAHQVVAPLA
3071|gene|hhi       TFYVDEDDAEEAEALLHARIVDDETLSSVTVEDDIAVIRVTGGD-PSQSALAHQVVEPLA
2374|gene|nrc1      TFYVDESVAERAENILHQEVIAVSELSSVTVTDDIAAIRVLGGELPNRPGVLCRIIDPLA
550|gene|nph        TFYVDAEVAEEAETVLHQAVIDLDELSSVTVDDDIAVIRITGGELPNNSGILEDIINPLA
2743|gene|hla       TFYVDVDVAETAEALLHEAVVEDEALSSVTVADPIAVIRVTGGELPNQSGVIQEIIAPLA
1005|gene|hwa       TFYISEDIASKAENLLHAKVINNQTLSSVTVDDGIAVIRVTGGELPNRPGVILDIVRPIA
2150|gene|hbo       TFYVGEDRAEEAENLLHSKVVDDQSLSSVTVDDDVAVIRVTGGELPNRPGVILDIVQPIS
                                                        .:.:                    

2505|hp|hhi         -----------------------DR-------------
1243|gene|hut       DAHINLLDVITSATSIAIFVPWEDREQALQLVQDAF--
12663|gene|hma      DAHIHLYDVITSATSVSVFVPWEDREQALSLVQDVF--
3071|gene|hhi       DAHIHLYDVITSATSVSVFVPWEDREQALSLVQDVF--
2374|gene|nrc1      DRNINVIDIISSATSVAVFVSWADREPALDVVQNGFGS
550|gene|nph        DAHINVLDLVTSATSVAVFLEWDDREDALEIIQDAV--
2743|gene|hla       DDGINIIDLITSATSVAVFVDWDDREDALEIVQSRFD-
1005|gene|hwa       EAGINIRDVITSATSVAVFVAWDDREETLSIVQSKF--
2150|gene|hbo       EAGINIHDVITSATSVAIFVAWDDREETLKIVQNEF--
                                           **