HOG Organism Gene ID Name Annotation
aHOG3723 hut HUTA0320 Huta_0320 transcription regulator brz (CPxCG-related small zinc finger protein)
aHOG3723 nrc1 VNG1466 vng1466 no entry
MUSCLE (3.6) multiple sequence alignment


320|gene|hut      MGIEQLSCPACGATFEMGLPRDVTVQSVTTEDREEPDDDRVKVRPNACSNGHECYVMFRF
1466|hp|nrc1      ----------------MGLPMGATVKSVTAASRQEPTSDTQKVRTVECRNDHEFFVRFEW
                                  **** ..**:***: .*:** .*  ***.  * *.** :* * :