HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0372COG0106KOG3055arCOG00618Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerasephosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase

HOG Organism Gene ID Name Annotation
cHOG0372 nrc1 VNG2294 hisA phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
cHOG0372 hmu HMUK0859 Hmuk_0859 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase( EC:5.3.1.16 )
cHOG0372 hma RRNAC2529 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
cHOG0372 hwa HQ1025A hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
cHOG0372 hla HLAC2699 Hlac_2699 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
cHOG0372 hbo HBOR02580 Hbor_02580 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4- carboxamide isomerase( EC:5.3.1.16 )
cHOG0372 hut HUTA2122 Huta_2122 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
cHOG0372 hvo HVO_2988 HVO_2988 hisA phosphoribosylformimino-5-aminoimidazole carboxamide ri
cHOG0372 nph NP1268A hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
cHOG0372 hhi 2959 hisA 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
MUSCLE (3.6) multiple sequence alignment


1025|gene|hwa       ----------------------------------------------------MSTLFESF
2294|gene|nrc1      ------------------------------------------------------MTFESF
2699|gene|hla       -----------------------------------------------------MSHFPSF
1268|gene|nph       -------------------------------------------------------MFPSF
2580|gene|hbo       ----------------------------------------------------MAEAFPTF
2122|gene|hut       -------------------------------------------------------MFPDF
12529|gene|hma      MTASSRRASGVRTNVAITIADLSYHSVKAWGYTGSDSRRTSRTDTLSTAATGPPAMYPEF
2959|gene|hhi       -------------------------------------------------------MYPEF
                                                                            :  *

1025|gene|hwa       EVIPAVDMQDGDVVQLVQGERGTETRYGDPVVAAKQWVEAGAKTLHLVDLDGAFEGDRMN
2294|gene|nrc1      TVLPAVDMQDGQVVQLVQGERGTERTYGDPVDAATDWVAAGAEALHLVDLDGAFEGARAN
2699|gene|hla       EVIPAVDVQDGEVVQLVGGERGTGKRYGDPVEAAERWIEAGAETLHLVDLDGAFEGERVN
1268|gene|nph       EVIPAVDMQDGQVVQLVGGERGTETEYGDPVAAAQRWVDAGAETLHLVDLDGAFEGERAN
2580|gene|hbo       EVVPAVDMQDGEVVQLVQGERGTEKRYGDPVAAAERWINEGADTLHLVDLDGAFEGERQN
2122|gene|hut       EVIPAVDMQDGQVVQLVGGERGTGKTYGDPVNAAERWVEAGAETLHLIDLDGAFEGERAN
12529|gene|hma      EVVPAVDMQDGQVVQLVGGERGTEKTYGDPVEAAQRWVDAGARTLHLVDLDGAFEGERQN
2959|gene|hhi       EVVPAVDMQDGQVVQLVGGERGTEKTYGDPVEAAQRWVDAGARTLHLVDLDGAFEGERRN
                     *:****:***:***** *****   ***** **  *:  ** :***:******** * *

1025|gene|hwa       ATAVDAIIDAV--DIPVQLGGGIRTANDAASLLDRGVNRVILGTAAVENPDLVAELAESY
2294|gene|nrc1      ATAVEDILDAT--DVSVQVGGGIRSAEDATALLDRGVDRVILGTAAIETPDIVGEIAAAY
2699|gene|hla       ADAIEAVVENVPDEIGLQLGGGIRTAEGARELLDLGLDRVILGTAAVETPEIVAEIDETH
1268|gene|nph       ADAVEAVLEAT--DVSVQLGGGIRTVDDADSLLSMGVDRVILGTAAVENPDIVGEINDRH
2580|gene|hbo       ADAVEAVVDAV--DVPVQLGGGIRTAADAIDLLERGVERVILGTAAVENPDIVREISDAH
2122|gene|hut       ADAIEAIQATV--DVDLQLGGGIRTAEDARALLDAGVDRVILGTAAVEDPEIVAEISETH
12529|gene|hma      AAAIDAVLDAVGADVDVQLGGGIRTAEDAVSLLDRGLDRVILGTAAVETPEIVGEISDEH
2959|gene|hhi       AAAIDAVLDAVGADVDVQLGGGIRTAEDAVSLLDRGLDRVILGTAAVETPEIVREISDEH
                    * *:: :   .  :: :*:*****:. .*  **. *::********:* *::* *:   :

1025|gene|hwa       PGRIIVSLDAADGEVVVSGWTESTGIDPAVAAARFADYGACGILFTDVDVEGKLAGIQSS
2294|gene|nrc1      SDGVLVSLDAKDGEVVVEGWTEGTGMDPVAAAQRYADLGAAGILFTDVDVEGKQEGVRTD
2699|gene|hla       PGSVVVSLDAKDGEVVVSGWTEGTGLDPAEAAARYEELGAGAILFTNVDVEGQLEGIDRE
1268|gene|nph       PGSVVVSLDAKDGEVVVSGWTESTGLDPAEAAARYEAEGAGGVLFTDVDVEGQLSGVRAD
2580|gene|hbo       PGSVMVSLDAKDGEVVVSGWTEGTGLDPAAAAARYEELGAGAILFTDVDVEGQLEGIQTA
2122|gene|hut       PDSVLVSLDASGGEVVVSGWTESTGLDPAKAAGRYAELGAAGILFTDVDVEGQLGGVRTA
12529|gene|hma      PGSVLVSLDAKDGEVVVSGWTEGTGLDPADAAGRYADLGAGGILFTDVDVEGQLDGVRTD
2959|gene|hhi       PGSVLVSLDAKDGEVVVSGWTEGTGLDPADAAERYADLGAGGILFTDVDVEGQLEGVRTD
                    .. ::***** .*****.****.**:**. ** *:   ** .:***:*****:  *:   

1025|gene|hwa       VTARVIDAVDIPVIASGGVASLDDIQTLHTTGAAATVVGTALYENKFTLADAMEVCESD-
2294|gene|nrc1      PVRDLVDSVDIPVIASGGVATVDDVRALEAAGAAGAVVGTALYEGNFTLADAQAAVED--
2699|gene|hla       AVESVVDAVEIPVIASGGVAAIDDVVALKEAGSAAVVVGTALYEGEFTLREAQTAADGK-
1268|gene|nph       EIARVVDAVDIPVIASGGVSTLSDIEALKDAGAAATVVGTALYEGEFTLEEAAAVV----
2580|gene|hbo       VTQRVVDAVTIPVVASGGVASLSDVRALKEAGAAAVVVGTALYEDAFTLQAAQDAVSED-
2122|gene|hut       PVERVVEAVDIPVIASGGVATVDDIRALEATGAAAVVVGSALYEGKFTLEDAIAAVE---
12529|gene|hma      PVRRLVDSVDIPVIASGGVATINDVLALRSAGAAAVVVGSALYEGQFTLDAAIDALGESS
2959|gene|hhi       PVRRLVDSVDIPVVASGGVATIDDVLALRSAGAAAVVVGSALYEGQFTLDAAIDALAED-
                        ::::* ***:*****:::.*: :*  :*:*..***:****. ***  *  .     

1025|gene|hwa       -
2294|gene|nrc1      -
2699|gene|hla       -
1268|gene|nph       -
2580|gene|hbo       -
2122|gene|hut       -
12529|gene|hma      E
2959|gene|hhi       -