HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0371COG1047arCOG00980FKBP-type peptidyl-prolyl cis-trans isomerases 2peptidyl-prolyl cis-trans isomerase

HOG Organism Gene ID Name Annotation
cHOG0371 nrc1 VNG1294 slyD peptidyl-prolyl cis-trans isomerase
cHOG0371 hmu HMUK2304 Hmuk_2304 peptidyl-prolyl cis-trans isomerase( EC:5.2.1.8 )
cHOG0371 hma RRNAC1230 slyD peptidyl-prolyl cis-trans isomerase
cHOG0371 hwa HQ2586A mtfK2 FKBP-type peptidylprolyl isomerase 2
cHOG0371 hla HLAC0806 Hlac_806 peptidylprolyl isomerase FKBP-type
cHOG0371 hbo HBOR15820 Hbor_15820 FKBP-type peptidyl-prolyl cis-trans isomerase( EC:5.2.1.8 )
cHOG0371 hut HUTA0515 Huta_0515 peptidylprolyl isomerase FKBP-type
cHOG0371 hvo HVO_1637 HVO_1637 slyD peptidyl-prolyl cis-trans isomerase
cHOG0371 nph NP3090A mtfK_2 FKBP-type peptidylprolyl isomerase 2
cHOG0371 hhi 1824 slyD peptidyl-prolyl cis-trans isomerase
cHOG0371 hhi 370 HAH_0370 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


370|hp|hhi          MSERVLFSVNHPAQVHLFKYAARELEAEGFETLVAAREKEMTVDLLSAEGLDYVTLTTES
2586|gene|hwa       -------MSDEPQAEEADTADS------------GIQDGDFV-------RLAYTLRTQED
806|gene|hla        -------MSDQEQADAAEDADEAETETE------GLADGDFV-------RVAYTIRTADD
15820|gene|hbo      -------MSDEQQAEAAEQADADATEDVEKETEGGIQDDDFV-------RLAYTVRTVED
1294|gene|nrc1      -------MSDEPEAEQADSSSDEQD---------GFQTGDFV-------ELSYTAYTVDS
11230|gene|hma      -------MSNESETDVDEETADEEEQAE------GLQKGDVV-------KLAYTARTVDG
1824|gene|hhi       -------MSNESETEVDEETADEEEQAE------GLQKGDVV-------KLAYTARTVDG
515|gene|hut        -------MSDDTAADEADTEAEHDAESN------GLQDGDFV-------TVAYTAWTVDG
3090|gene|nph       -------MSDESEAVEETDAAESEEADADTQDVDGLQDGDFI-------RIDYTARTVEE
                             :                        .    :.         : *.  * : 

370|hp|hhi          DGLVELTAELAKRERRLYNLAREFDPSVIVARLAPPAVHVATALGCRNLVYMDTVLRPRT
2586|gene|hwa       ETVIDTTDPEVAEEAGLDDDEREFEPRVLV-------------IGAGH------------
806|gene|hla        DRVIDTTDEEVAEDAEIDTEEHEFEPRVIA-------------LGAGH------------
15820|gene|hbo      DTVVDTTDEAVAEEAEIDTDEYEFEPRTII-------------VGAGH------------
1294|gene|nrc1      EELVDTTDEEIAESEGVDTDEQEFSPRTIV-------------LGEEH------------
11230|gene|hma      GQLVDTTDEEVAEDDGIDTEQQEFGPRTIV-------------LGENH------------
1824|gene|hhi       GQLVDTTDEEVAEDDGIDTEQQEFGPRTIV-------------LGENH------------
515|gene|hut        GDLVDTTSQEVADEEGV-GEDQEFEPRTIV-------------LGEGH------------
3090|gene|nph       DQLVDTTDEDVAEEEGV-ADQGEFEPRVIV-------------LGEGH------------
                      ::: *      .  :     ** * .:              :*  :            

370|hp|hhi          VRLLYHGLTLPFVDDICSPPGMDFHVP----FGQSHTVGFQELAYLHPDRFKPDPERLRA
2586|gene|hwa       ---LFPSVEDAILDTTAGDSG-AVEIPADDAFGEYDE---DEVRTISANKI-DDDNQYPG
806|gene|hla        ---VFPSVEEAFIGAEVGDEG-VVDVPAEDAFGEYDP---DEVETVKADKI-PEDSRYPG
15820|gene|hbo      ---IFESVDDELIGSEVGDSG-TVEIPAAEAFGEFDD---DEVRTVSANKI-AEDDRYPG
1294|gene|nrc1      ---IFAAVEDDIVGQSVGDDG---TVLVEEAFGEYDE---DEVRTVSANKI-PEDDRYPG
11230|gene|hma      ---IFPDVEQDIYGKEVGDEG-DVTVAAADAFGEYDE---EEVRTVSKDKI-PEDDRYPG
1824|gene|hhi       ---IFPDVEQDIYGKEVGDEG-NVTVAAADAFGEYDE---EEVRTVSKDKI-PEDDRYPG
515|gene|hut        ---IFPDVEDDITGKEIGDEG-SVVVPAVDAFGEYDD---EEVRTISANKI-DEDDRYPG
3090|gene|nph       ---LFPDVEDDIRGKEVGDEG-SVVVESEEAFGEYDE---EEVRTVSADKI-DEDDRYPG
                       ::  :   : .   .  *    :     **:      :*:  :  :.:  : ..  .

370|hp|hhi          HGVNPDATY-TVVRLAGWDAYHDIGEK--GLDTDARSQLVEQLCDRGE-------VYITC
2586|gene|hwa       AQVQIDGDQGRIITIINTRARVDFNHPLAGQDLEYEYEVRDIVEDPEAKAESLLGMYLQT
806|gene|hla        AQVQIDNRQGYLETIIGGRARVDFNHPLAGEDLEYEYEILEAIEDREQQAAGMLGMYLQE
15820|gene|hbo      AQVQVDGEQGRVETIIGGRARVNFNHPLAGEDLEYEYEVLELVEDREEQAGGLLGMYLQQ
1294|gene|nrc1      AHVDVDGEHGHVEAIIGGRARVDFNHPLAGEDIEYEYEVLDEITDREQQAVGFLEMMFDV
11230|gene|hma      AHVDLEGEHGHVETIIGGRARVDFNHPLAGEDVEYDYEVLEEVTDREEKAQGIIQMMLDM
1824|gene|hhi       AHVDIEGEHGHIETIIGGRARVDFNHPLAGEDVEYDYEILEEVTDREEKAQGIIQMMLDM
515|gene|hut        AAVTIDGEQGYIETIIGGRARVDFNHPLAGEDIEYDYEILDTVDDREEQAASLLDTMLGM
3090|gene|nph       ARIQIDGQQGVLETIIGGRARVDFNHPLAGEDIEYNYEVLETVEGDLEQAEGLLGMFLDL
                      :  :     :  : .  *  ::.    * * :   :: : : .            :  

370|hp|hhi          EGDLPTEYD---RHQLAVPP------------------------------HLVHDLLYFA
2586|gene|hwa       PPTVRIETD-TVEEEQSVETADESETAAEDDVDADTESEIEAEVEPPVETETETVEVEKE
806|gene|hla        APEVRIETV-TEEEETVSEDDDGEE-------------------------VVETEDVEKD
15820|gene|hbo      VPDVWIQTD-EVEEEQVVESDEDE--------DEDAEP------------ETETVTVDKE
1294|gene|nrc1      ELDVDLVTE-TVEEEVTEETEDGD-------------A------------ETTTESVEKE
11230|gene|hma      ELDVWFETD-TVEEEQLVESEDED-------EDEESEP------------EYETVEVEKE
1824|gene|hhi       ELDVWFETD-TVEEEQLVESEDDEDEDSEESEDTSDEP------------EYETVEVEKE
515|gene|hut        ELDVWFETDVEEEEEIVEEADDLE--EAAEEGEDEDGP------------VTETVEVEKD
3090|gene|nph       DLDMWVETD-EVEETRVEEPDEDD---------EDAEP------------ETVTETVEKR
                       :                                                    :   

370|hp|hhi          DLYIGDSQTMPTEAA-LLGTPAIRINSVVGDNDMHNFLELEERELLYSYTDGTAAIDRAD
2586|gene|hwa       TLYVDSTPEMQMNQQWLFSKQQIA-------EEVIDRTGIDRMIIQETLDGRGGMMGGLG
806|gene|hla        VLYVTATQAMQMNQQWMFQKQQIA-------QDLMSRLDLDRVVVEEVIEGGGMG--GLG
15820|gene|hbo      TLYIEATPQMTMNQQWMFSKQQIA-------QDLMDRLDLDRVIVQETIDGMGGMMGGMG
1294|gene|nrc1      TLYIEQSPQLQFNQQWMMGKSQVL-------SQVIDMLDIDRVIVQEIIDGQPAGMPGMG
11230|gene|hma      TLYIEATPQLTMNQQWMMGKQQIA-------QQLTQLLDIDRIIVQEEIGGGGMGMP---
1824|gene|hhi       TLYIEATPQLTMNQQWMMGKQQIA-------QQLTQLLDIDRIIVQEEIGGGGMGMP---
515|gene|hut        TLYIEATPQLSMNQQWMFQKQQIA-------QQFVELLGVDRVIVQETLGEGGGMMGGMG
3090|gene|nph       TLYVESTPQLSMNQQWMMQKQQIA-------QQVIDLTDIDRILIQEILDGGGMGM-GMG
                     **:  :  :  :   :: .  :        .:. .   ::   :               

370|hp|hhi          SLLSDD--------------------DAERWERERKRLLAQQRDVTEHMVELIR--TGGN
2586|gene|hwa       GMMGGMGPELDAEDDVETDIDESDDVDIEETVEDLEELEDVDIDAEELAAEL----GDVE
806|gene|hla        GMMGGMGGAGA--------------EDIEEA------LEDVDVDADEIVDEI----D--E
15820|gene|hbo      GMMGGMGGGAD-------------AADIEEA------IEDVDVDADELVEELEDEVDGDD
1294|gene|nrc1      GMMGGAGGDLG---------------DVEDA------LEDADVDADEIVDEL----D--D
11230|gene|hma      GMMGGMGGAGG--------------ADIEDA------LEDADVDAEEIVEEI----EGAE
1824|gene|hhi       GMMGGMGGAGG--------------ADIEDA------LEDADVDAEEIVEEI----EGAE
515|gene|hut        GMMPGMGGGGG---------------DLEDA------LEDADVDADELAEEL----D-VE
3090|gene|nph       GMMGGMGGAGG------------EDVDLEEA------LEEADIDADEIADEL----E---
                    .:: .                     * *        :   : *. *   *:        

370|hp|hhi          D
2586|gene|hwa       E
806|gene|hla        E
15820|gene|hbo      E
1294|gene|nrc1      E
11230|gene|hma      E
1824|gene|hhi       E
515|gene|hut        E
3090|gene|nph       -