HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0370COG2897KOG1529arCOG02019Rhodanese-related sulfurtransferaseprobable thiosulfate sulfurtransferase (cysA)

HOG Organism Gene ID Name Annotation
cHOG0370 nrc1 VNG2393 tssA probable thiosulfate sulfurtransferase (cysA)
cHOG0370 hmu HMUK1146 Hmuk_1146 Rhodanese domain protein( EC:2.8.1.1 )
cHOG0370 hma RRNAC2129 sseA2 thiosulfate sulfurtransferase
cHOG0370 hwa HQ3729A cysA thiosulfate sulfurtransferase
cHOG0370 hla HLAC1687 Hlac_1687 Rhodanese domain protein
cHOG0370 hbo HBOR01970 Hbor_01970 rhodanese-related sulfurtransferase( EC:2.8.1.1 )
cHOG0370 hut HUTA2095 Huta_2095 Rhodanese domain protein
cHOG0370 hvo HVO_0025 HVO_0025 tssA thiosulfate sulfurtransferase
cHOG0370 nph NP3186A cysA thiosulfate sulfurtransferase
cHOG0370 hhi 2614 sseA2 thiosulfate sulfurtransferase
MUSCLE (3.6) multiple sequence alignment


2095|gene|hut       -----MGTVYMIGCIMTEYANDVLVSAEWVEDNLSEFESDDPAHRLVEV-------DVDT
12129|gene|hma      -----MSGRLTLRCIMTDYANDVLVSADWVSEHLDEFQSDDPAHRLVEV-------DVDT
2614|gene|hhi       ---------------MTDYANDVLVSADWVSEHLDEFQSDDPAHRLVEV-------DVDT
2393|gene|nrc1      ------MYVGVHPLRMADYATDVLVTADWVDDHLDQFRSDDPDHRLVEV-------DVDT
3729|gene|hwa       MGVKPTQYIYIDVMTTDDYAKDVLVSPEWVTDRLDEIQSDDPDYRLVEV-------DVDT
1970|gene|hbo       -------------MSTDGYAKDVLVSPEWVEDHLDEFQSDDPAYRLVEV-------DVDT
1687|gene|hla       ------------------MTDDVLVTADWVESNLDAFQDDDSDLRLVEINNPTVTDESEY
3186|gene|nph       ---------------MTEHDSPTLVSADWVEEHLEDFQSDDPEYRLLEVNNPTVTADSEY
                                          .**:.:** ..*. : .**.  **:*:       : : 

2095|gene|hut       EAYDEAHAPGAIGFNWESQLQDQTTRDILSKADFEDLLGSHGISEDSTVVLYGDN--SNW
12129|gene|hma      ELYDESHAPGAIGFNWETDLQDQTTRDILDKDDFEDLLGAHGISEDSTVVLYGDN--SNW
2614|gene|hhi       ELYDESHAPGAIGFNWETDLQDQTTRDILDKDDFEDLLGAHGISEDSTVVLYGDN--SNW
2393|gene|nrc1      EAYEESHAPGAIGFNWETQLQDQTTRDILDKDAFESLLGSHGITEDSTVVLYGDN--SNW
3729|gene|hwa       EAYDEAHAPGAIGFNWETQLQDPTTRDILDKEDFETLLGNHGISDDSTVIIYGDN--SNW
1970|gene|hbo       EAYDEGHAPGAIGFNWETQLQDQTTRDILTKEEFEDLLGSHGISEDSTVVLYGDN--SNW
1687|gene|hla       TPYEEGHIPGALNFEWDEVFTDETERDIVSKADFAERNGAAGIDADTTVVVYGGGRVPNW
3186|gene|nph       TPYEEGHIPGAIFFDWDDDLSDETTRDILDKDAFEELNAEAGITEESTIVLYGGGRVPNW
                      *:*.* ***: *:*:  : * * ***: *  *    .  **  ::*:::**..  .**

2095|gene|hut       FAAYTYWQFKYYGHDDVKLLDGGREYWVENDYPTTSEEPDFSAVEYDASGPRESIRAYRE
12129|gene|hma      FAAYTYWQFKYYGHDDVKLLDGGREYWVENDYELTDEVPEFSEVDYEAAGPRESIRAYRE
2614|gene|hhi       FAAYTYWQFKYYGHDDVKLLDGGREYWVENDYELTDEVPEFSEVDYEAAGPRESIRAYRE
2393|gene|nrc1      FAAYAYWQFKYYGHDDVKLLDGGRDYWMDNDYPTSEEPPSFSATDYDASGPFEGIRAYRD
3729|gene|hwa       FASYTYWQFKYYGHDDVRLLNGARDYWLDNDYPVTDEVPEYSTVEYEARGPFESIRAYRD
1970|gene|hbo       FAAYTYWQFKYYGHDDVRLLNGGRDYWLENDFPLSEEAPDFDAVEYNAKGPFESIRAYRD
1687|gene|hla       FALFGYWIYTYYGHDDVRVIDGGKGYWVDNDYPLSTEAPDFTSREYEARGPFESVRAYKD
3186|gene|nph       FALFAYWQYRYFGHDDVRIIDGGKPYWVENDYPLTADEQAFAAQEYEASGPYESIRAYKS
                    ** : ** : *:*****.:::*.. **::**:  : :   :   :*:* ** *.:***..

2095|gene|hut       DVENAIERGLPLVDVRSPEEFRGDILAPPGLQETAQRGGHVPGAQNISWAAVTNDDGTFK
12129|gene|hma      DVENAIERELPLVDVRSPEEFSGEILAPPGLQETAQRGGHVPGAQNISWAAVTNDDGTFK
2614|gene|hhi       DVENAIERELPLVDVRSPEEFSGEILAPPGLQETAQRGGHVPGAQNISWAAVTNDDGTFK
2393|gene|nrc1      DVENAIDKGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGAENISWAATVNADGTFK
3729|gene|hwa       DVDHAIDQDLPLVDVRSPEEFSGEILAPPGLNETAQRGGHIPGASNISWADTVNDDGTFK
1970|gene|hbo       DVQHAVDEGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGAENISWAATVNADGTFK
1687|gene|hla       DIDKAIEEGIPMVDVRSPEEFSGEVIAPEGLNETAQRGGHIPGASNVPIGTTLNEDGTFK
3186|gene|nph       DVEQAIDSGIPLVDVRSPEEFTGEVIAPEGLQETAQRGGHIPGAKSVPTTSVLDDDGTFK
                    *:::*::  :*:********* *:::** **:********:***..:.   . : *****

2095|gene|hut       DFDELAELYSDYGIDGDSTTVAYCRIGERSSVAWFALHELLGYDDAINYDGSWTEWGNLV
12129|gene|hma      DYDELEELYAEYGIDGDSTTVAYCRIGERSSVAWFALHELLGYDDTINYDGSWTEWGNLV
2614|gene|hhi       DYDELEELYAEYGIDGDSTTVAYCRIGERSSVAWFALHELLGYDDTINYDGSWTEWGNLV
2393|gene|nrc1      SADELRSLYADQGIDGDETTVSYCRIGERSSIAWFALHELLGYDNTVNYDGSWTEWGNLV
3729|gene|hwa       SAEELESIYADYDIDGSETTVAYCRIGERSSIAWFALHELLGYDEVVNYDGSWTEWGNLV
1970|gene|hbo       SAEELEELYADQGIDGNETTVAYCRIGERSSIAWFALHELLGYDEVVNYDGSWTEWGNLV
1687|gene|hla       SADELRELYADAGVDGDESTITYCRVGERSSIEWFLLHELLGYDDVRNYDGSWTEWGNLV
3186|gene|nph       GPDELRELYEDVGITEDQSVITYCRVGERSSIEWYVLAELLGFDDVQNYDGSWTEWGNTI
                    . :** .:* : .:  ..:.::***:*****: *: * ****:*:. *********** :

2095|gene|hut       GAPIEKGEADD
12129|gene|hma      GAPIEKGEADD
2614|gene|hhi       GAPIEKGEAE-
2393|gene|nrc1      GAPVETGE---
3729|gene|hwa       GAPIETGGAD-
1970|gene|hbo       GAPIEKGN---
1687|gene|hla       GAPIETGE---
3186|gene|nph       RAPIETGDAE-
                     **:*.*