HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0037COG0496arCOG02303Predicted acid phosphatasestationary phase survival protein

HOG Organism Gene ID Name Annotation
cHOG0037 nrc1 VNG1241 surE stationary phase survival protein
cHOG0037 hmu HMUK2355 Hmuk_2355 stationary-phase survival protein SurE( EC:3.1.3.5 )
cHOG0037 hma RRNAC0514 surE acid phosphatase SurE
cHOG0037 hwa HQ3350A surE acid phosphatase
cHOG0037 hwa HQ3676A surE acid phosphatase
cHOG0037 hla HLAC2324 Hlac_2324 stationary-phase survival protein SurE
cHOG0037 hla HLAC1292 Hlac_1292 Survival protein SurE
cHOG0037 hbo HBOR19110 Hbor_19110 5'-nucleotidase /3'-nucleotidase (EC 3.1.3.6)/exopolyphosphatase (EC 3.6.1.11)( EC:3.1.3.5 )
cHOG0037 hbo HBOR00500 Hbor_00500 5'/3'-nucleotidase SurE( EC:3.1.3.5 )
cHOG0037 hut HUTA0271 Huta_0271 stationary-phase survival protein SurE
cHOG0037 hvo HVO_1314 HVO_1314 surE Acid phosphatase surE
cHOG0037 nph NP4208A surE acid phosphatase
cHOG0037 hhi 1127 surE acid phosphatase SurE/5'-nucleotidase
MUSCLE (3.6) multiple sequence alignment


3676|gene|hwa       MMKDEYSILLTNDDGIDAPGLATLRTELTALGNVTVVAPESNQSGVGRTRN---PTAIVR
500|gene|hbo        -MSDGYTILLTNDDGIDAPGIATLREELTSLGDVTVIAPDGNRSGVGRTRN---HTAVVR
2324|gene|hla       ---MTTEILLTNDDGIDAVGIRALADALSRDYDVTVVAPASNQSGVGGARSWWDTTVEYT
1292|gene|hla       --MSVERVLLTNDDGIDAVGLRALYDGLSADYDVVTVAPTGDRSSAGRALS---DGVDIA
19110|gene|hbo      -MDDAFSILLTNDDGIESTGFRALYEAFDQFADVTAVAPAADQSAVGRKMS---NDVDVT
3350|gene|hwa       -MSESLSVLLTNDDGIDAVGIQALYQAFDDIAEVTVVAPTDDQSAVGRQLS---SDVTIH
4208|gene|nph       -----MDVLLTNDDGIDAVGIRALYDALAEVADVTAVAPADDQSAVGRQLS---RTVELH
1241|gene|nrc1      MDADEPEILVTNDDGIDAPGIRALADGLDAVGNVTVVAPADNQSATGRAMS---QEVAVH
271|gene|hut        -MNEEPTILLTNDDGIDSVGLGALYDALSTVGDVTAVAPAADRSAVGRSIS---TNVGVS
10514|gene|hma      --MDEPTILLTNDDGIESAGLRAVYDGLSTVGDVTAVAPAEDQSAVGRAIS---HEVTVH
1127|gene|hhi       --MDEPTILLTNDDGIESAGLRAVYDGLSTVGDVTAVAPAEDQSAVGRAIS---HEVTVH
                           :*:******:: *: ::   :    :*..:**  :.*..*   .     .   

3676|gene|hwa       DHPWGCALTGTPADCVAYGLRGLDTNIDIVVAGVNNGPNAGNYVVGRSGTVGAGIEAAFL
500|gene|hbo        EHPWGYALSGTPADCVAYGLRGLDTDFDVVVSGVNDGPNAGNYVVGRSGTVGAGIEAAFL
2324|gene|hla       ETDAGYAVEGTPADCVAVADVALGLDPDVVVSGCNHGPNIGAHILGQSGTVGAAMEASFL
1292|gene|hla       DHELGYAVDGTPVDCVVAGLDALVPDADVVVAGCNKGANLGAYTLGRSGTVSAAVEAAFF
19110|gene|hbo      EHELGYAIDGTPADCTVVGLEALCPDVDMVVAGCNKGANIGAYVLGRSGTVSAAVEAAFF
3350|gene|hwa       EHDWGYGIDGTPADCVVAGVEALCPDVDLVIAGCNKGANIGAYVLGRSGTVSAAVESTFF
4208|gene|nph       DHELGYAVEGTPADCVIAGLGALDLDPDIVVAGCNEGANLGEYVLGRSGTVSAAVEAAFF
1241|gene|nrc1      DHDLGYAVEGTPADCVVAGLEALGPYPDLVVSGVNEGGNLGMYVLGRSGTVSAAVEAAFF
271|gene|hut        DHELGYAIDGTPADCVVAGMEVLLDDVDIVVAGCNDGANLGAYVLGRSGTVSAAVEATFF
10514|gene|hma      EHELGYAVEGTPSDCVVAGLEALVTDTDLVVAGCNRGANLGAYVLGRSGTVSAAVEATFF
1127|gene|hhi       EHELGYAVEGTPSDCVVAGLEALVTDTDLVVAGCNRGANLGAYVLGRSGTVSAAVEATFF
                    :   * .: *** **.  .   *    *:*::* * * * * : :*.****.*.:*::*:

3676|gene|hwa       GTPALAISAY----HSTDFFISPPEEYDFARPARIARRLVDRALSAGVYDD----VDLLN
500|gene|hbo        GTPALAVSAF----HTTDFFLSPPEEYDFSRPARVAVGLVERALDSGVYDD----VDLLN
2324|gene|hla       GTPAIAVSLY--DRGNLP-VPPTLDNGDFAVAGEVVVDLLDRAETGSEGPSLPFGADVLN
1292|gene|hla       DVPAVATSMYVPGGED--WWKRKLEPAEFANATRATRYLVAEATASGAFDR----ADYLN
19110|gene|hbo      DVPAMAVSLYVPPGGDVPWTEKADDIADYRHAADAATYLAKNAPEAGVFEE----AEYLN
3350|gene|hwa       DVPAMAVSMYIPGGGDTPWHKQATEVSAFADASRAATYLARHAFDAGVFEQ----ADYLN
4208|gene|nph       GVPAIAASVYFPA-GDVTIEEFDPDKTDFAEASRAVRYLVDNAIGAGVFDA----ADYLN
1241|gene|nrc1      GVPAIAVSMYMREEQ----FGEPTAVADYEHAVDATTHLAHDAVTDGIFDT----ADYLN
271|gene|hut        DVPAIAVSMYVPVRDDDKWDPLTEEPGSYANATRAARYLVDRGLESGVFEQ----ADYLN
10514|gene|hma      DVPAMAVSMYIPVREDAAFADIEANGDSYREAAKATTYLADHAVDAGVFEQ----CDYLN
1127|gene|hhi       DVPAMAVSMYIPVREDAAFADIEANGDSYGEAARATTYLADHAVDAGVFEQ----CDYLN
                    ..**:* * :                  :  .   .  *   .   .         : **

3676|gene|hwa       VNAPVD------TANPPVMLTDPYHDYEQEVEQASADDVSD-------DVTLESNEHLVQ
500|gene|hbo        VNAPVD------SPNPPVMLTEPYHDYGQQVEEVEDEDD-----------ELGPDERRVE
2324|gene|hla       VNVPAADDEA--AADPTYRLTEPARGFDVIEFHPGEAEPEDENVPEGWEFSERRGEMGME
1292|gene|hla       VNAPIANPDGERDTPAPMRVTAPSTWYGMEAAHDG-NGR-------------------VS
19110|gene|hbo      VNAPMPN-G---QDPAPIEITTPSKMYAMTARHDDENGR-------------------IT
3350|gene|hwa       INAPVAA-----NEPATLEVTRPSRVYDMTAEHDG-NGT-------------------VT
4208|gene|nph       VNAPLPP-E---TGHAPMEITEPSHVYEMDGERDG--ET-------------------VR
1241|gene|nrc1      VNAPHPD-A---DATGEMVVTRPSHAYDMTAAQTG--DT-------------------VT
271|gene|hut        VNAPLAVEG---NATAPMEITTPSRVYEMGAVENG--EE-------------------IE
10514|gene|hma      INAPVAE-----WGDAQMTVTRPSHLYEMDAEQDG--DA-------------------VT
1127|gene|hhi       INAPVAE-----WGDAQMTVTRPSHEYEMDAVQEG--DA-------------------VT
                    :*.*               :* *   :                               : 

3676|gene|hwa       LRDRTWPGVVGWESPFPPTDEHRRRYPVGTDRRALVDAAVSVSPLSVTHGSPDSAALATI
500|gene|hbo        LRDRTWPDAVGWENPFPLAETHRERYPVGTDRRAMVDAAVSVSPLTVSHGVADSARLADV
2324|gene|hla       LRDRFWREFLRGDVADDP----------GSDRLAAVEGEVSISPLSSSRSIAGDRAGEVV
1292|gene|hla       FSDPIWGKMNEGDVPDSV----------GTDRRAVIDGEVSVSPLSVPHAAEPDAGLDEL
19110|gene|hbo      LHDRIWERMQSGDIPDPQ----------GTDRRAIVDGRVSVSPLTAPHTTKRHDALDSL
3350|gene|hwa       LHDRVWERMRTDDIPDPS----------GTDRRAVVDGHISVSPLAAPHTTEHHEALDAL
4208|gene|nph       IQDHIWERMAEGTIPDPP----------GTDRRAVVEGRVSVSPLTAPHPTTGHEGLAGL
1241|gene|nrc1      LYDRLWEAMAAGDIHDPD----------GTDRRAVLDGHVSVSPLTAPHSTEHHDALDGI
271|gene|hut        LHDRIWEWMAEGTIPDPD----------GTDRRAVVEDRISVSPLTAPHTTEHHETLDAL
10514|gene|hma      LHDRIWEHMADGDIPDPE----------GTDRRAVVDGKVSVSPLTAPHTTEHHEALDAI
1127|gene|hhi       LHDRIWEHMAEGDIPDPE----------GTDRRAVVDGKVSVSPLTAPHTTEHHEALDAI
                    : *  *                      *:** * ::  :*:***: ..          :

3676|gene|hwa       VETVDVA-------
500|gene|hbo        IETFEVE-------
2324|gene|hla       EDPAADSAAGIEQD
1292|gene|hla       AAAYGRVTENVR--
19110|gene|hbo      AESYLAE-------
3350|gene|hwa       ASTYLDSI------
4208|gene|nph       AEKYQ---------
1241|gene|nrc1      ATEF----------
271|gene|hut        AAEYEKTE------
10514|gene|hma      AETYEPDDGGEAAD
1127|gene|hhi       AETYEPGDGGEAAD