HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0368COG1234KOG2121arCOG00501Metal-dependent hydrolases of the beta-lactamase superfamily IIIhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0368 nrc1 VNG2239 vng2239 no entry
cHOG0368 hmu HMUK1067 Hmuk_1067 ribonuclease Z( EC:3.1.26.11 )
cHOG0368 hma RRNAC2500 metallo-beta-lactamase-like
cHOG0368 hwa HQ3403A elaC ribonuclease Z (RNase Z) (tRNA 3 endonuclease)
cHOG0368 hla HLAC0076 Hlac_76 ribonuclease Z
cHOG0368 hbo HBOR29660 Hbor_29660 RNAse Z( EC:3.1.26.11 )
cHOG0368 hut HUTA2187 Huta_2187 ribonuclease Z
cHOG0368 hvo HVO_0144 HVO_0144 rnz ribonuclease Z
cHOG0368 nph NP2254A hypothetical protein
cHOG0368 hhi 2931 HAH_2931 metallo-beta-lactamase-like/ribonuclease Z
MUSCLE (3.6) multiple sequence alignment


2187|gene|hut       --MRVTFLGTSGAVPTTERNPSAVMVRREGERLLFDCGEGTQRQMMHFGTGFDVAHIFVS
12500|gene|hma      MTMRVTFLGTSGAVPTTQRNTSSIFVNRDGDYLLFDCGEGTQRQMMRYGTGFAIDHLFVT
2931|gene|hhi       --MRVTFLGTSGAVPTTQRNTSSIFVNRDGDYLLFDCGEGTQRQMMRYGTGFAIDHLFVT
2239|chp|nrc1       MTLEVTFLGTSGAVPTTERNPSSVFVRRNGDAFLFDAGEATQRQMMRYKTGFGVSDVFIT
2254|hp|nph         MSLRVTFLGTSGAVPTTRRNTSAVFLRREGDRMLFDCGEGTQRQMMRFGTGFAVSKAFIT
76|gene|hla         MSLRVTFLGTGGAVPTTERAPSALFVNREGDRLLFDCGEGTQRGMMRFGTGFGIDHLFVS
3403|gene|hwa       --MRATFLGTGGAVPTTERGPSAFFVERDGERLLFDCGEGTQRQMMRFGTGFSLSHIFVT
29660|gene|hbo      MSMRVTFLGTGGAVPTTERGPSAFLVNRDGERLLFDCGEGTQRQMMRFGTGFTVSHLFVT
                      : .*****.****** * .*:.:: *:*: :***.**.*** **.: *** :   *::

2187|gene|hut       HMHGDHVLGIPGLLQTMDFNEREEPLAIHAPHGTRSQLEALIGATGDRPSYPLRITQNGP
12500|gene|hma      HLHGDHVLGIPGLLQTWDFNERERAIAIHTPAGTRGNIKQLIQANGTTPSFPVRINEVSA
2931|gene|hhi       HLHGDHVLGIPGLLQTWDFNERERAIAIHTPAGTRGNIKQLIQANGTTPSFPVRINEVSA
2239|chp|nrc1       HGHGDHVFGLPGLVHTWDFNDRTDPLTIHVPRGLRGDIEDLVFSAGGDVGYPVRITEATP
2254|hp|nph         HLHGDHILGLPGLLQTMDFNDREEPLSVYVPSGKQAELRDLIDTAAGAPSFPVHVNGVSD
76|gene|hla         HLHGDHVLGIPGLVQTLGFNDRAEPLTIHCPPGTEDDLHDLVHAVGHDPAFQIRIESVAP
3403|gene|hwa       HLHGDHILGIPGLIQTLDFNDRTDALAIHGPPGSKPHLRHLVETAGYRPGYPINIREIRP
29660|gene|hbo      HLHGDHVLGIPGLIQTWDFNDREEPIAIHAPPGSKRHLQSLVNAGGYRPSFPVNIHEVKP
                    * ****::*:***::* .**:*  .:::: * *    :  *: : .   .: :.:     

2187|gene|hut       GDVVLDANEYEVQAIETEHR-TQSLGYALVEDDRKGRFDRETAENELGIEPGPKYSKLHA
12500|gene|hma      GDVVLDRSEYEIRAIETAHR-CASVGYVLDEDDRKGKFDREKAEEEFGIPPGPKYSKLHR
2931|gene|hhi       GDVVLDRSEYEIRAIETEHR-CASVGYVLDEDDRKGKFDREKAEEEFGIPPGPKYSKLHR
2239|chp|nrc1       GAVVRSHDDYEVRAFETAHS-TASVGYALVEDDRTGRFDRARAE-ELGVPVGPKFSTLHD
2254|hp|nph         GQVVVDADDYEIRAFETDHD-ARSLGYALIEASRKGRFDRERAE-ELGVPVGPKFQQLHA
76|gene|hla         GEVALDADGYEVRAFETVHR-TKSQGYVLEEDDRPGRFDRPKAE-ELGVPVGPKFGRLHE
3403|gene|hwa       GSVAVDTEEYIIRSFETSHRGVTSIGYALIESDRKGRFNRDRAE-SLGVPVGPKFGRLHD
29660|gene|hbo      GNVALSGDSYEVRTFETDHRNVRSMGFALVEDDRPGRFNREKAE-ALGVPVGPDFGRLHE
                    * *. . . * :.::** *    * *:.* * .* *.*:*  **  :*:  **.:  ** 

2187|gene|hut       GEAVE-HDGRTIQPEEVVGPPRPGRTVVYTGDTRPVEAVRRASEDADLLIHDGTFGDDRA
12500|gene|hma      GEAVE-HEGETIQPEAVVGPARPGRRFVYTGDTLPTESVIEASEDADLLVHDATFAEDRK
2931|gene|hhi       GEAVE-HDGETIQPEAVVGPARPGRRFVYTGDTLPTESVIEASEDADLLVHDATFAEDRK
2239|chp|nrc1       GQPVELDDGTVVSPEQVVGDPRPGRTLVYTGDTRPHDPVVSAAEDADLLIHDATFANDAS
2254|hp|nph         GEAVELEDGTVVEPEQVVGDPRPGRRVVYTGDTRPTDRTVTVAENADLLIHDATFATDNA
76|gene|hla         GEPVEAEDGSIVEPDQVVGPPRPGRKFVYTADTRPREGTVAVAEDADLLVHDATFADDME
3403|gene|hwa       GESVKLADGSIVHPEQVVGDSRPGRRVVYTGDTRPTETTVEAANNADLLVHDATFAADRA
29660|gene|hbo      GESVELEDGTVIHPEQVVGDPRPGRRLVYTGDTRPVDATVDVVDEPDLLIHDATFAEDRA
                    *:.*:  :*  : *: *** .**** .***.** * : .  . ::.***:**.**. *  

2187|gene|hut       ARARRTGHSTAREAGSLAAEAGAKRLALTHISTRYAGRSDQLLEEAREAFGEA-AFVAAD
12500|gene|hma      ERAKATAHSTAREAADVARQAGASTLALTHISTRYAASADELVDEARDAFDGE-VVLAED
2931|gene|hhi       ERAKATAHSTAREAADVARQAGASTLALTHISTRYAASADELVDEARDAFDGE-VVLAED
2239|chp|nrc1       ERAAETGHSTAGEAADVATEAGAKALALTHVSSRYAGDASEISAGA-SGFDGE-AFVAHD
2254|hp|nph         DRAARTAHSTAAEAADIASRADARRLALVHISSRYAGDPSPIEREADDAFGGE-AFVPED
76|gene|hla         DRARDTAHSTGREAGSVAERAGAKRLALVHISSRYAADASPIRREAREAFDGE-CLLPDD
3403|gene|hwa       SRAKQTGHSTAQEAAQIATRADARQLALTHVSSRYAGDVTPLESDATAAFDGQRAFVPDD
29660|gene|hbo      ERAHGTGHSTGREAAEIANRAGARRLALTHISSRYAGDASPIEREAQAAFDGE-AFVPQD
                     **  *.***. **..:*  *.*  ***.*:*:***.    :   *  .*.    .:. *

2187|gene|hut       GQSIDVPYPDDG---------
12500|gene|hma      GMERRVEFPDADEY-------
2931|gene|hhi       GMERRVEFPDADEY-------
2239|chp|nrc1       GLTHEIPFPDAD---------
2254|hp|nph         GDTVDIPFPDE----------
76|gene|hla         GDLIEVPFPDADE--------
3403|gene|hwa       GYTLDIPFPDADDNHLSDNIP
29660|gene|hbo      GQKIDIQFPDADE--------
                    *    : :**