HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0366arCOG01305recB like nuclease

HOG Organism Gene ID Name Annotation
nucHOG0366 nrc1 VNG2211 rbl2 recB like nuclease
nucHOG0366 hmu HMUK0667 Hmuk_0667 DNA topoisomerase type IA zn finger domain protein( EC:5.99.1.2 )
nucHOG0366 hma RRNAC2963 top1 topoisomerase DNA binding C4 zinc finger
nucHOG0366 hwa HQ1045A topA DNA topoisomerase I
nucHOG0366 hla HLAC2506 Hlac_2506 DNA topoisomerase I
nucHOG0366 hbo HBOR03040 Hbor_03040 predicted nuclease of the RecB family( EC:5.99.1.2 )
nucHOG0366 hut HUTA1668 Huta_1668 DNA topoisomerase type IA zn finger domain protein
nucHOG0366 hvo HVO_2953 HVO_2953 topoisomerase DNA binding C4 zinc finger
nucHOG0366 nph NP0446A homolog to DNA topoisomerase I
nucHOG0366 hhi 223 top1 topoisomerase DNA binding C4 zinc finger
MUSCLE (3.6) multiple sequence alignment


2211|hp|nrc1        MQDAIRVLAGECAVRYENDASTDRVLRGDVVVVVKPDDTVLVHDADGYQPAAWLTRPGVV
446|gene|nph        --MPIRTITGDCLVRFEGP--RDRTVRGTVLAVVKPDNTVLVHDIDGYQPAAWLTRASEL
1668|gene|hut       MHDGIHVVAGECTTTFDGSRVREHEQRGQVLVVVKPDNTVLVHDAEGYQPVAWLTRAETV
12963|gene|hma      MHDGTRVIAGECTTVFEGP--REREQRGDVLVVVKPDNTVLVHDAEGYQPVAWLTRAESV
223|gene|hhi        MHDGTRVIAGECTTVFEGT--REREQRGDVLVVVKPDNTVLVHDAEGYQPVAWLTRAESV
2506|gene|hla       MPERLRVFAGDCRVTERGD--RSRTHRGRVVVLIKPDDTTLVHDADGYQPVAWLTRPDSV
1045|gene|hwa       MDKTIRVFAGDCTTTFEGS--DDQTQRGRVVVIIKPDQTVLVHDTDGYQPVAWLTRSDSI
3040|hp|hbo         MSETIRVFAGDCTTTFEGS--RSRTQRGRVVVVVKPDRTVLVHDADGYQPVSWLTRPDSL
                         ...:*:* .   .    ..  ** *:.::*** *.**** :****.:****.  :

2211|hp|nrc1        RYTRDASGFRIDAADGDERLVVESATEHGDAHYPVSPAGPPVGRC-ECGGAFVRDGGRVV
446|gene|nph        SLTRD--PLWLVAVDGDETLRIEAVGDVTVTEHEATVAGTPVGNC-RCGGDLVRSGGGVS
1668|gene|hut       TIDGT----HLAATDGDQRLTVEIHDETASGRYPASAAGSPVGECPDCGAALVRVTDAVA
12963|gene|hma      TIDSG----TVTARDGDELLRVVTHDEHGSARYPASNAGVPVRDCPDCAGTLVRARSEVT
223|gene|hhi        TIDDG----AVTARDGDELLRVVPHEEHGSARYPASNAGVPVRDCPDCAGTLVRTRSDVT
2506|gene|hla       VVEGDGDGFSITARDGTRRLRVVAEEATASRALPVTEAGFPVGTCPEDGGVLVRSRGDVV
1045|gene|hwa       TVESDVGGFGITARAGEQVLRIIGHEVTGHAEYPVTEAGIPVGRHPKSGESLIQTSNMIT
3040|hp|hbo         TVETDRSGFGLVARADEQVLRIRSHETSGWAEYPASEAGVPVGSHPQTGEPLVRVGGAVV
                              : *  .   * :            .: ** **      .  ::.  . : 

2211|hp|nrc1        CVDCRDQYSIPRDVAVVDDACAACGLPRIRVARGVTVTACVDRDCEPIAAAVADAID--W
446|gene|nph        CLDCGERFGLPSGATTTGDDCS-CGLPTVRVDRGEPFELCLDPDCGSLLEAVRAAFEGEW
1668|gene|hut       CTGCDERYGLPGDAEVIDDHCE-CGLPKMRVERGRAFEVCVDRECESMDDAVAEVFDREW
12963|gene|hma      CTGCDAAYGIPSDAAVTGGRCGDCGLPTLRVERGRAFELCLDRGCDSLDDAVTAAFDREW
223|gene|hhi        CTGCDAAYGIPSDAAVTGGRCDDCGLPTLRVERGRAFELCLDRDCDSLDDAVTAAFDREW
2506|gene|hla       CLDCETRWGLPAGASVTDGVCEDCELPKIRIERGEPFHLCLDPACDPMEAAVSDRFDRVW
1045|gene|hwa       VINSDIKYPLPKGATVQDECCESCGLPMIEATAGERFSICLDRECESLDDAVRERFDDEW
3040|hp|hbo         GLDTETRYGLPAGATVVDETCDDCGLPKISAECGAVFELCVDRACESLDDAVRDRFDDEW
                      .    : :* .. . .  *  * ** :    *  .  *:*  * .:  **   ::  *

2211|hp|nrc1        TC-RCGAALGVASERG-LHAACE---SCGARFRLPHGTTAGDCGCGLPAIRTATGVRCLD
446|gene|nph        ACPECGSDLDIIRRGG-LLAGCEQYPDCETAFSIPDGVVDGRCGCGLPVFETATGRRCLD
1668|gene|hut       DCPNCEGDLRILRRGG-LLAGCEHYPECDTGFAFPAGVVVGECACGLPLFETAGGRRCLD
12963|gene|hma      DCPNCDGDLLVLRRGG-LLAGCEHYPDCDTGFSMPSGVVVGNCDCGLPLFETAGGTRCLD
223|gene|hhi        DCPNCDGDLLMLRRGG-LLAGCEHYPDCDTGFSIPSGVVVGDCDCGLPLFETAGGTRCLD
2506|gene|hla       GCPDCEGDLTVQSAPGRVYLACENRPGCETTFSIPSGVVVDECDCGLPVFETAAGRGCLD
1045|gene|hwa       TCPDCGAPMQIIRRSGRLLAGCSGYPACETAFAIPTGVVVDVCSCGLPIFETSRGQQCLD
3040|hp|hbo         TCPDCGSPLSIIRRGGRLLAGCSAYPDCETAFSIPAGVVVDDCDCGLPVFETARGRRCLD
                     *  * . : :    * :  .*.    * : * :* *.. . * **** : *: *  ***

2211|hp|nrc1        GDCERAPQSL-------
446|gene|nph        TDCSVGRDR--------
1668|gene|hut       ATCEAWRDGTGGVPAES
12963|gene|hma      SSCEKQG----------
223|gene|hhi        SSCSELG----------
2506|gene|hla       GSCEYEGHTASE-----
1045|gene|hwa       GTCELLNKTDEG-----
3040|hp|hbo         GTCAQFE----------
                      *