HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0365COG1236KOG1361 KOG1135 KOG1136 KOG1137arCOG00541Predicted exonuclease of the beta-lactamase fold involved in RNA processingmRNA 3'-end processing factor homolog

HOG Organism Gene ID Name Annotation
cHOG0365 nrc1 VNG2512 epf1 mRNA 3'-end processing factor homolog
cHOG0365 hmu HMUK0378 Hmuk_0378 beta-lactamase domain protein
cHOG0365 hma RRNAC2133 epf1 mRNA 3'-end processing factor
cHOG0365 hwa HQ1121A epf mRNA cleavage and polyadenylation specificity factor-like protein
cHOG0365 hla HLAC1796 Hlac_1796 beta-lactamase domain protein
cHOG0365 hbo HBOR04230 Hbor_04230 predicted exonuclease of the beta-lactamase fold involved in RNA processing
cHOG0365 hut HUTA1893 Huta_1893 beta-lactamase domain protein
cHOG0365 hvo HVO_1797 HVO_1797 epf mRNA 3'-end processing factor
cHOG0365 nph NP0670A epf1 mRNA cleavage and polyadenylation specificity factor-like protein
cHOG0365 hhi 2616 epf3 mRNA 3'-end processing factor/RNA-metabolising metallo-beta-lactamase
MUSCLE (3.6) multiple sequence alignment


1796|gene|hla       --------MEVEFLGGAREVGRSAVLVDDALLIDYGLLTADPPQYPLRDPEPDAVVVSHG
1121|gene|hwa       --------MDIRFLGGAEEVGRSAILINDRLLLDYGMLTGNPPQFPIETPRPDAVVVSHG
4230|hp|hbo         MRLAIKSNMDIRFLGGAREVGRSAILVNDRLLLDYGMLTGNPPQFPVDTPEPDAVVVSHG
670|gene|nph        --------MELQFLGGAGEIGRSAVLVNGSLLLDYGIQTATPPQYPVGDVEPDAVVVSHG
2512|gene|nrc1      --------MDLRFLGGAREVGRSALLVGESLLLDFGTKADTPPQFPVSTPTPDAVVASHG
1893|gene|hut       --------MKLRFLGGAGEVGRSAILVNESLLLDYGMKTETPPQFPVGTVDPEAVVASHG
12133|gene|hma      --------MDVQFLGGADEIGRSAVLIDESLLLDFGMLTDSPPQFPVRTPSPDAVVVSHG
2616|gene|hhi       --------MDVQFLGGAGEIGRSAVLIDESLLLDFGMLTDSPPRFPVRTPSPDAVVVSHG
                            *.: ***** *:****:*:.  **:*:*  :  **.:*:    *:***.***

1796|gene|hla       HLDHVGAVPALLKGDRRPTIHWTPPTAAIARVLARDTLKLH-----------------GN
1121|gene|hwa       HLDHVGAIPSLLSGDRRPPIHWTAPTQELALTLARDTLKLH-----------------GG
4230|hp|hbo         HLDHVGAVPSLLSGDRRPPIHWTPPTRELALTLARDTLKLRGISGRGATGGSQGQRRRGG
670|gene|nph        HLDHAGAVPSLLSGDRRPPIHWTPPTRELALTLARDTLKLH-----------------GG
2512|gene|nrc1      HLDHVGTIPALLSGTHRPPIHWTPPTYELALTLARDTLKLH-----------------GG
1893|gene|hut       HLDHVGSIPSLLSGSRRPPIHWTPPTRELALTLARDTLKLH-----------------GG
12133|gene|hma      HLDHVGTIPALVSGDARPPIHWTPPTYELAMTLARDTLKLH-----------------GG
2616|gene|hhi       HLDHVGTIPALVSGDARPPIHWTPPTYELAMTLARDTLKLH-----------------GG
                    ****.*::*:*:.*  **.****.**  :* .********.                 *.

1796|gene|hla       SPLCPFSEEHVARLGEVEERHTYAEPFVVEAGGTAYEVTLFNAGHIPGSAHVLVDDGNTR
1121|gene|hwa       TYDCPFTQEELHRVTQVSETHGYRETF--DVAD--HSITFYNAGHIPGSAHVLIDDGDTR
4230|hp|hbo         TYDCPFTEEEIRRVTQVSETHSYRETF--EAAG--HEVTFYNAGHIPGSAHVLIDDGDTR
670|gene|nph        SYRCPFTETAVKRVTQVSESHGYRESF--EAAG--HEVTLFDAGHIPGSAHVLVDDGETR
2512|gene|nrc1      TYHCPFIENDIKRVTEVSRTHGYGVPF--DAAG--YEVTFYNAGHVPGSAHVLVDDGDTR
1893|gene|hut       TYDCPFTEVDVRRVTQVSETHGYREPF--EVAG--HEVTFFNAGHIPGSAHVLVDDGETR
12133|gene|hma      TVNCPFTETNVRRVTQVSETHGYRESF--EAAG--YEVTFYNAGHIPGSAHVLVDDGDTR
2616|gene|hhi       TVNCPFTETNVRRVTQVSETHGYRESF--EAAG--YEVTFYNAGHIPGSAHVLVDDGDTR
                    :  *** :  : *: :*.  * *  .*  :...  :.:*:::***:*******:***:**

1796|gene|hla       LLYTGDFHTDDQRLVSGTTDRPDADVVICESTYADVTHEDRRVVEDRWVERVRTTLWEGG
1121|gene|hwa       LFYTADFHTENQRLVSASTARPEADVVICESTYSDVQHDPRKQIETRFVESVRTTMWQGG
4230|hp|hbo         LFYTADFHTDDQRLVSASTARPDADVIICESTYSDVEHERRQRIEKRFVESVRTAVWEGG
670|gene|nph        LLYTGDFHTDDQRLVAGTSARPDADVVVCESTYADVDHDPRADVEDRFAQSVKTTLWEGG
2512|gene|nrc1      LLYTGDFHTTDQRLVSGTTARPEADVVVCESTYSDVTHDDRDSVEARFAESVKTTLWEGG
1893|gene|hut       LLYTGDFHTDNQRLVAGTTARPDADVVLTESTYSDVSHEDRATLEERFAESVKTTLWEGG
12133|gene|hma      LLYTGDFHTDDQRLVAGTTARPDADAVICESTYSDVDHDPRETVEGRFVESVETTLWEGG
2616|gene|hhi       LLYTGDFHTDDQRLVSGTTARPDADAIICESTYADVDHEPRETVEERFVESVETTLWEGG
                    *:**.**** :****:.:: **:**.:: ****:** *: *  :* *:.: * *::*:**

1796|gene|hla       TVVAPAFAIGRTQELMLVAEANDLTPYVDGMGVEVTRLVRRHPEFLRDPEALRRATGAAR
1121|gene|hwa       TVIVPAFAIGRTQELLLVCAANNIDCYVDGMGKQVTKMLKEHPQFIRGEEALGHAKSNAR
4230|hp|hbo         TVVIPAFAIGRTQEMLLVCAANDIDCYVDGMGKQVTKMLRRHPEFVRDEDALRRAKSNAR
670|gene|nph        TVVVPAFAIGRTQEMLLVCEAHDIPCYVDGMGKQVTEMLRGYPGFVRDDEAFRRAKSHAR
2512|gene|nrc1      TVVVPAFAIGRTQELLLVCDAHDIPCYVDGMGKRVTEMLLRYPGFVRDGDALRRAKSHAR
1893|gene|hut       TVVIPAFAIGRTQEMLMICEAHDIPCYVDGMGKRVTKMLRRHPEFVRDPDALQRAKSHAR
12133|gene|hma      TVVVPAFAIGRTQEMLLVCEAHDIPCYVDGMGKQVTEMLGQYPEFVRDADALQRAKSHAR
2616|gene|hhi       TVVVPAFAIGRTQEMLLICEAHDIPCYVDGMGKQVTEMLGQYPEFVRDADALQRAKSHAR
                    **: **********::::. *:::  ******  ** ::  :* *:*. :*: .*.. **

1796|gene|hla       FVTGRDGQRKRIAGDNALIITTSGMLAGGPVHSYLPEIRSNPTNTVTLTGYQVEGTPGRE
1121|gene|hwa       FVTGRDGQRKRIAEQNTVIVTTSGMLSGGPAMTYIPEIRSNPTNKITLTGYQVEGTPGRS
4230|hp|hbo         FVTGRDGQRRRIAKQNTVIVTTSGMLSGGPAMTYVPEIRSNPTNKITLTGYQVEGTPGRD
670|gene|nph        FVTGRDGQRKRIAEENAAIVTTSGMLSGGPAMTYIPEIRAHPTNMVALTGYQVEGTPGRR
2512|gene|nrc1      FVTGRDGQRKRIADQQAAIVTTSGMLSGGPAMTYIPEIRSNPVNKIAMTGYQVAGTPGRS
1893|gene|hut       FVDGRDGQRKRIAAQNTAIVTTSGMLSGGPAMTYIPEIRDRPVNKIALTGYQVEGTPGRD
12133|gene|hma      FVTGKDGQRKRITDQKAAIVTTSGMLSGGPAMTYIPEIRGNPMNKITMTGYQVEGTPGRD
2616|gene|hhi       FVTGKDGQRKRITDQKAAIVTTSGMLSGGPAMTYIPEIRGNPMNKITMTGYQVEGTPGRD
                    ** *.****.**: ::: *:******:***. :*:**** .* * :::***** ***** 

1796|gene|hla       LQERGRLAINGTVRPVSARVESFDFSAHADRGGLEAFLESYR--GSRVLVNHGDRCEAFA
1121|gene|hwa       LLETGRAEINDRIMPISAQVEWYDFSAHADKDGLMELLNEYK--DTRVLINHGDRCQRFA
4230|hp|hbo         LLERGRAEIDERVMPVSAQVEWYDFSAHADRDGLLELLSAYR--EAPILVNHGDRCELFA
670|gene|nph        LVETGRAEIDGRVMPVSAQIEQYDFSAHADREGLVSFLDPYRGGDTEALVVHGDRCADFA
2512|gene|nrc1      LIDSGRAEIDGRVLPVSAQVEQYDFSAHADHAGLRAFLDDYR--DATVLVNHGDDCAAFA
1893|gene|hut       LLETGSAEIDGQRMPVAAQVESYDFSAHADRAGLDAFLDAYR--ETQLLVNHGDRCEQFA
12133|gene|hma      LLETGSAEIDGRIMPVSARVEQYDFSAHADRDGLFAYLDSYR--DTPVLVNHGDRCEAFA
2616|gene|hhi       LLETGSAEIDGRIMPVSARVEQYDFSAHADRDGLFAYLDSYR--DTPVLVNHGDRCEAFA
                    * : *   *:    *::*.:* :*******. **   *. *.   :  *: *** *  **

1796|gene|hla       ADLRGDGFDASAPELGERVEL-
1121|gene|hwa       DELNASEFDATAPTLGQEISI-
4230|hp|hbo         DELNDDGFDASAPELGEKVTVN
670|gene|nph        ATLSERGLPASAPEVGETVHI-
2512|gene|nrc1      DALRDAGFTARAPERDDTCPV-
1893|gene|hut       AELAGDGFDATAPSIGETVEVR
12133|gene|hma      TTLREDGYDATAPELGATVAIQ
2616|gene|hhi       ATLRQDGYDATAPELGATVDIQ
                      *      * **  .    :