HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0364COG1226 COG0618KOG1418arCOG01566hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0364 nrc1 VNG0650 vng650 no entry
cHOG0364 hmu HMUK2163 Hmuk_2163 phosphoesterase RecJ domain protein
cHOG0364 hma RRNAC1272 hypothetical protein
cHOG0364 hwa HQ1649A phosphoesterase-like protein
cHOG0364 hla HLAC0324 Hlac_324 phosphoesterase RecJ domain protein
cHOG0364 hbo HBOR21350 Hbor_21350 exopolyphosphatase-like enzyme
cHOG0364 hut HUTA2844 Huta_2844 phosphoesterase RecJ domain protein
cHOG0364 hvo HVO_0990 HVO_0990 conserved protein
cHOG0364 nph NP2316A hypothetical protein
cHOG0364 hhi 1864 HAH_1864 phosphoesterase RecJ domain-containing protein
cHOG0364 hhi 4210 HAH_4210 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4210|hp|hhi         M--------------------------------------------TELRVRKPDGWTTVS
2316|hp|nph         -MDRLVLGCAPGTRQFVEQLAEQPASLLVLVGDEARADTLRDSG-IDTRVVDPTDPAAIR
11272|hp|hma        MLSRLVLGLGPTAADLLDAISDDRGELAVVTQDEHRAETLRADG-INVLEADQADPSVLA
1864|gene|hhi       MLSRLVLGLGPTAADLLDAISDDRGDLAVVTQDEHRAETLRADG-INVLEADQTDPSVLA
1649|gene|hwa       MNRRLLLGCGPAVHDAVEQFIDRSGHLTIVTQHETVFESFNGED-IDHTQANPDDSTVYP
324|gene|hla        MARRLLLGCSAVGNTLVERTREARGELIAITDDTGWASTLRDRN-VATVEADPTDPATYP
21350|gene|hbo      MQRRLVLGCGSAAQRAVERLAEWPGTLTVLSQRSGVVDSFRDDG-VSAERCAPTDHEAFP
650|chp|nrc1        MVSRLVLGCGTVGHAVIGSLADRRGELFVFDGDESRVDSLRNES-VAAEVRDVTDPAAIT
2844|gene|hut       MRTRLVVGSGSIARAVIGSLCERPGRLLA-TGSDEREDSLRENGAVEVLAVDPTVHSQLA
                                                                                

4210|hp|hhi         FPDAVATILVAGGKVDGQLCLTLTAEREDGP-----------------------------
2316|hp|nph         TVAGDAASVVVAPEASPEAAAIADAARSAYPDTFLLACFGR-------QPSEPVRSEVAA
11272|hp|hma        DLDFHPESIIVASEDPKQNADAATAARDCFPDAFLLAYAGH-------GATTDQRDRLDS
1864|gene|hhi       DLDVHPESVIIASEDPEQNADAATAARDCFPDVFLLAYAGR-------GATADQRDRLDS
1649|gene|hwa       P---TADMIFIASDEAKQNAITAETARTEFPNTHITSFVPA-------TASQKIRERINC
324|gene|hla        E---SAAVVLVASDDPARNVAAAEAARRHYPDAMIVAHVGT-------NPTAAQQEALEA
21350|gene|hbo      E---EVDVVFVASDDAAANLDVALTARERFPDAYLLAYVGS-------DADHDTREALDE
650|chp|nrc1        LPDRSVDMVVVAGERADRNRLAAIAADAAHPDAGLVVYLGF-------DATPKDRHRIDS
2844|gene|hut       EVEADVETVVVASDNPAENLVVARAARRAFPSAFLLVYAGATVQDDRIGQRAERLAELRS
                            :. . .          :     *                             

4210|hp|hhi         ---RLVEPG---------------------------------------------------
2316|hp|nph         VADRVVDGLAETRDKLLAAVGEGGL-RTRKLQHVLRTIDGPLAVVAHDNPDPDAIGSAIG
11272|hp|hma        VADRLVTPETVVTDYVTQSVGDEGT-RARQLHQVLRDIDDHLAVVMHDNPDPDAIASAVA
1864|gene|hhi       VADRLVTPESVVTDYVTQSVGDEGT-RARQLHQVLRDIDDHLAVVTHDNPDPDAIASAVA
1649|gene|hwa       VSNHVIDARQALVSRFNDILTHPGARQLHQLFTTLRDIDDTLAIVMHDAPDPDAIASALA
324|gene|hla        VADRVVDPVEAVVSRVCEATGVDADEEPVRLLRVLRSLTGPLLVVAHDNPDPDAIASALG
21350|gene|hbo      LADRLVDGRRILTDRLTELTEGAAADRLHRLFRVLKSLSGPLAVVMHDNPDPDAIASALA
650|chp|nrc1        VADRVVDPGAELLSHANSLTESGASQRLQALRQTLQGIDGRLGVFMHDNPDPDAIAAAVG
2844|gene|hut       VADRVVDPGTVLDSYLEDRIETGGI-SIHEFRRVLEDVDGTLAVVMHDNPDPDAIASAIA
                       .::                                                      

4210|hp|hhi         ------------------------------ILDVD----------ENDEH----LLENTV
2316|hp|nph         LKRIAEAAGVEATACYYGDINHQENRALVNLLEFDLRSLDADC--DPSSFGGIALVDHSR
11272|hp|hma        LGALAERADCEVTICYYGEISHQENRAFVNLLEFDLRNLDADSPDELEAFDAFALVDHSR
1864|gene|hhi       LGALAERADCEVTICYYGEISHQENRAFVNLLDFDLRNLDADSPDELDAFDAFALVDHSR
1649|gene|hwa       LAELADNADIDADLCYYGSISHQENRALVNLLDIDLLNFERET--DVEEYDSIALVDHSR
324|gene|hla        LARIAESVGIPADACYGGEIAHQENRAMVNLLDLSLRTFD-GI--DLDDYGGVALVDHSR
21350|gene|hbo      LVRIAESVGLDADPCYFGDISHQENRALVNLLDIDLVNLERGE--DTDDYGGIALVDHSR
650|chp|nrc1        LQRIAEDAGVDSQACYFGEISHQENRAFVNLLEFDLRNVETQS--DAE-FDAVALVDHSG
2844|gene|hut       LVQIAERLGCSAEACYYGSINHQQNRAFVNLLDLDLTSLEPDA--DLDVYGGFALVDHAR
                                                  :*:..          : . .    *:::: 

4210|hp|hhi         PRIEDG------TSVVLDRLLPS-------------------------------------
2316|hp|nph         PGANDGLPPEADIDIVIDHHPPRQPIQARFVDLRSDVGATCTLVAGYLRELGIPIDENLA
11272|hp|hma        AGVNDQLPPETPIDIVIDHHPPRVPIEARFVDLRSGVGATSTLLVDYLQRFNVDIPTPIA
1864|gene|hhi       AGVNDQLPPETPIDIVIDHHPPRVPIEARFVDLRSGVGATSTLLVDYLQRFNIDIPTPIA
1649|gene|hwa       PGVNDGLAPDTTVDIVVDHHPPRATVEASFVDIRRNVGATSTIFADYLRRINAAPTESVA
324|gene|hla        AGINDSLPEGHPVDIVVDHHPPRGPVAGEFVDIRPDVGATSTLIEEYLSRVGIEPDRDLA
21350|gene|hbo      PGVNDGLPKDTEVDIVVDHHPPRAPVEARYLDLRRELGATSTLMTNYLRRLGIEPDATVA
650|chp|nrc1        PGVNDQLAPDTDVDIVIDHHPPTTDVDAGFTDIRPDTGATSTILVEYLRGYGIDVRTAVA
2844|gene|hut       PGVNDGLPGDTAVDIVIDHHPPRGPVTAAFTDLRSDVGATSTLLVDYLRRFDVDIEETVA
                    .  :*        .:*:*.  *                                      

4210|hp|hhi         ------------------------------------------------------------
2316|hp|nph         SGLLYGIWTDTQSFSRGVARADFEAAAALIETADREALQRIESPSVTAGTLETVQRAISN
11272|hp|hma        TGLLFGIQVDTKDFRREVAAADFEAAAHLVTNADMATLQRIEDPSVSPETLSVIGRAITN
1864|gene|hhi       TGLLFGIQVDTKDFRREVAAADFEAAAHLVTNADMATLQRIEDPSVSPETLSVIGRAIAN
1649|gene|hwa       TALLFGIRTDTNDFAREVSAADFEAAAWLLTHANLSTLDNVESPQMTSGVLETLSSAIQN
324|gene|hla        TALLYGIRIDTKDFTRATSIPDFEAAASLSPHADESTLERVESPSVSPETLRVLARAIEG
21350|gene|hbo      TALLFGIRIDTRDFTREVSSDDFEAAAWLVSYADLSTLQRVESPSMGPEVLDTLARAIQN
650|chp|nrc1        TALLYGIRVDTDDFAREITPRDFTAAAWLLPNADTDVLERIEAPSLSADTFDTIAAGIRN
2844|gene|hut       TALLFGIRVDTNEFSREVSVADFEAGAFLLREADLGMLERIEDPSMSSDTFETIADAIHN
                                                                                

4210|hp|hhi         ------------------------------------------------------------
2316|hp|nph         RTVRDDVLVTCVGQVSDRDALSQAADKLLNMQDISTTLVCGYTDETVFISARARAADLDL
11272|hp|hma        RDQEGSVLLTGVGEISDRDALAQAADRLLDLEGVQTTMVYGVVDGTIYVSARARGADIDL
1864|gene|hhi       REQEGSVLLTGVGEITDRDALAQAADRLLDLEGVQATMVYGVVDGTIYASARARGADIDL
1649|gene|hwa       RDVRGNALASNVGSITDRDSLAQAADHVLNLKGVKIAIVYGWIDDTVYLSGRARGVDIDL
324|gene|hla        RDVRGSTVASCVGEIGDRDALSQAAERLLDLDGIAVTFVFGYMDGVIYGSARARGADLDV
21350|gene|hbo      RDVRGDVLATNVGEIRNRDALAQASDHLLNMEGIRLTVVYGFKDGTVYVSGRARGTDVDL
650|chp|nrc1        RQLNGSVLASCVGQITARDTLAQTADRLLAMRGVAVTFVYGYFDGTIYVSARSRRKDLDL
2844|gene|hut       RDRHGTVLLSGVGELRDRDTLAQAADRLLAMDGVTTTLVYGINAGTIYISARSRGTDLDL
                                                                                

4210|hp|hhi         ------------------------------------------------------------
2316|hp|nph         GETLREAFGQIGSAGGHADMAGAQIPVGILLDDADERER--RSVIEDVITERFFEAVGMT
11272|hp|hma        GEALRDAFGQIGSAGGHADMAGAQIDVGMITV--DDREESLEEIVRAIVSNRFLDAVQSR
1864|gene|hhi       GEALRDAFGQIGSAGGHADMAGAQIDLGMITV--DEREESLEEIVRSIVSDRFLDAIQSR
1649|gene|hwa       GETLRSALGTVGSAGGHADLAGAQIPLDALNLAQEESTDDHYATISDAVSTRVFGALDNK
324|gene|hla        GELLRDALDPVGSAGGHATMAGAQVPLGILQEVSES--ESLEDVVEAFVAGRFFEALDDA
21350|gene|hbo      GETLRDALSPIGSAGGHADMAGAQIPLGILADVGPESRESLSRVVTDVISGRLFETLEDA
650|chp|nrc1        GAVLRSAFDDLGSAGGHADMAGAQLPLGLFDAVGEDAATTLTEMIEEVVASRFFEEVHGG
2844|gene|hut       GETLRAAFGQIGSAGGHADMAGAQLDLGVMETISDD--DDLEAIVEEIVTDRFLDAMEVY
                                                                                

4210|hp|hhi         ------------------------------------------------------------
2316|hp|nph         P-----------DYVPFVYADTFGGVE---------------------------------
11272|hp|hma        SHRLLGRVYARADYDVAAFTESTALSQDSDDTSATAEGASGEAGDDGTADWNSDVMFLEN
1864|gene|hhi       SHRLLGRVYARADYDVAAFTESTALRRDSGDTITTPGDTPAGSSDDTATDWNSDVLFLED
1649|gene|hwa       TT-VLEPEESGSTVEPFQFPQKTQ------------------------------------
324|gene|hla        PSPPTGP--------LPEFSRE--------------------------------------
21350|gene|hbo      TRTFGASESERD--LAFEFPPDEW------------------------------------
650|chp|nrc1        TSGIQQGE----------------------------------------------------
2844|gene|hut       PSQLPSESYGEGTELPDDAAPVSPQLGSGRRNGVAENRPEDTVDRYRVDDTDGETETRST
                                                                                

4210|hp|hhi         ------------------------------------------
2316|hp|nph         ------------------------------------------
11272|hp|hma        GDEDGGDEPDQAADAAEPTDDEAEQGEDSPETLVEPDDGEPL
1864|gene|hhi       GDEDGG--------------DESEQADDSPETLVEPDDSEPP
1649|gene|hwa       ------------------------------------------
324|gene|hla        ------------------------------------------
21350|gene|hbo      ------------------------------------------
650|chp|nrc1        ------------------------------------------
2844|gene|hut       DGSDTV--------------GDDNDGT---------------