HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0362COG0595arCOG00546Predicted hydrolase of the metallo-beta-lactamase superfamilypredicted hydrolase

HOG Organism Gene ID Name Annotation
cHOG0362 nrc1 VNG1149 hym predicted hydrolase
cHOG0362 hmu HMUK2607 Hmuk_2607 beta-lactamase domain protein
cHOG0362 hma RRNAC0080 hydrolase
cHOG0362 hwa HQ2890A hydrolase
cHOG0362 hla HLAC2047 Hlac_2047 beta-lactamase domain protein
cHOG0362 hbo HBOR11920 Hbor_11920 predicted hydrolase of the metallo-beta- lactamase superfamily
cHOG0362 hut HUTA2048 Huta_2048 beta-lactamase domain protein
cHOG0362 hvo HVO_2724 HVO_2724 predicted hydrolase
cHOG0362 nph NP3698A hydrolase
cHOG0362 hhi 837 HAH_0837 hydrolase
MUSCLE (3.6) multiple sequence alignment


2047|gene|hla       ------------MEIEIATLGGYEEVGRQMTAVRAGEDIVIFDMGLNLSKVLIHDNVETE
1149|chp|nrc1       ------------MEIEIATIGGYEEVGRQMTAVRAGDDIVIFDMGLNLSKVLVHDNVETE
2890|gene|hwa       ------------MEIEIATIGGYEEVGRQMTAVRTGDDIVIFDMGLNLSQVLIHDNVETE
11920|hp|hbo        ------------MEIEIATIGGYEEVGRQMTAVRAGDDVVVFDMGLNLSQVLIHDNVETE
2048|gene|hut       ------------MEIEIATIGGYEEVGRQMTAVRAGDDVVIFDMGLNLSKVLIHDNVETE
3698|gene|nph       ------------MEVEIATIGGYEEVGRQMTAVRAGDNVVIFDMGLNLSKVLIHDNVETE
10080|gene|hma      MPAAGFPLGATTMEVEIATIGGYEAVGRQMTAVRAGDDVVIFDMGLNLSKVLIHDNVETE
837|gene|hhi        ------------MEVEIATIGGYEAVGRQMTAVRAGDDVVIFDMGLNLSKVLIHDNVETE
                                **:****:**** *********:*:::*:********:**:*******

2047|gene|hla       SMHSLDLIDMGAIPDDRVMSELEGDVQAIVPTHGHLDHIAGIPKLAHRYDAPIVGSPYTI
1149|chp|nrc1       KMHSLDLIDMGAIPDDRVMSDLEGDVKAIVPTHGHLDHIGAISKLAHRYDAPIVGSPFTI
2890|gene|hwa       TMHSLDLIDMGAIPDDRIMSDLEGDVQAIVPTHGHLDHIGALSKLAHRYDAPIVGSPFTI
11920|hp|hbo        KMHSLDLIDMGAIPDDRVMSDLEGDVKAIVPTHGHLDHIGAISKLAHRYDAPIVASPFTI
2048|gene|hut       RMHSLDLIDMGAIPDDRVMSEIEGDVKAIVPTHGHLDHIGAISKLAHRYDAPIMATPFTI
3698|gene|nph       RMHSLDLIDMGAIPDDRVMSDIEGDVQAIVPTHGHLDHIGAISKLAHRYDAPIVATPFTI
10080|gene|hma      RMHSLDLIDMGAIPDDRVMSDLEGDVKAIVPTHGHLDHIGAISKLAHRYDAPIVATPFTI
837|gene|hhi        RMHSLDLIDMGAIPDDRVMSDLEGDVKAIVPTHGHLDHIGAISKLAHRYDAPIVATPFTI
                     ****************:**::****:************..:.**********:.:*:**

2047|gene|hla       ELVKQQIADEGKFQVDNDLVKMKAGGTMAIGDSEQVEMEFVNVTHSIIDAINPVLHTPEG
1149|chp|nrc1       ELVKGEIESEQKFGVENDLVKMEAGGTMEIGDRC--ELEFVHVTHSIIDAINPVLHTPEG
2890|gene|hwa       ELVKQQIDSENKFNVNNDLLKMSAGEAMSIGESGNVELEFVHVTHSIIDAINPVIHTPEG
11920|hp|hbo        ELVKQQVEGENKFNVGNDLVKMEAGEMMSIGDSGNVELEFVHVTHSIIDAINPVLHTPEG
2048|gene|hut       ELVKQQIQGEEKFGVENDLVKMDAGATTSIGDDG-VELEFVNVTHSIIDAINPVLHTPEG
3698|gene|nph       ELVKQQIEGEEKFGVQNDLVKMDAGGTMPIGEKC--ELEFVNVTHSIIDAINPVLHTPEG
10080|gene|hma      ELVKQQIKSEEKFGVQNDLVKMDAGETMSIGERN--ELEFVNVTHSIIDAINPVLHTPEG
837|gene|hhi        ELVKQQIKSEEKFGVQNDLVKMDAGETMSIGERN--ELEFVNVTHSIIDAINPVLHTPEG
                    **** :: .* ** * ***:**.**    **:    *:***:************:*****

2047|gene|hla       AVVYGLDKRLDHTPVIGDPIDMDRFREIGRQDEGVLCYIEDCTNAGRKGRTPSESYAKKH
1149|chp|nrc1       AVVYGLDKRMDHDPVLEDPIDMERFREIGREGEGVLCYIEDCTNAGKKGRTPSESTARRH
2890|gene|hwa       AIVYGLDKRIDHSPVLEDPIDMKRFREIGREDNGVLCYIEDCTNAGRKGRTPSESHARSH
11920|hp|hbo        AIVYGLDKRMDHSPVLEDPIDMKRFREIGREGNGVLAYIEDCTNAGRKGRTPSESVARKH
2048|gene|hut       AIVYGLDKRMDHDPVVGDPIDMDRFREIGE--EGVLCYIEDCTNAGKKGRTPSESVARKH
3698|gene|nph       AVVYGLDKRMDHNPVLGDPIDMDRFREIGR--EGVLCYIEDCTNAGKKGKTPSESVARSQ
10080|gene|hma      SVVYGLDKRMDHSPVIGDPIDMKRFREIGREGEGVLCYIEDCTNAGKKGRTPSESVARRH
837|gene|hhi        AVVYGLDKRMDHTPVIGDPIDMKRFREIGREGEGVLCYIEDCTNAGKKGRTPSESVARRH
                    ::*******:** **: *****.******   :***.*********.**.***** *. :

2047|gene|hla       VEDTLTSMEDYSGGIVATTFSSHIARVKTLVEYAREIGRQPVLLGRSMEKYSGTAERLDF
1149|chp|nrc1       LKDVLTSVADYDGGIVATTFSSHISRVSSLVEFAKEIGREPILLGRSMERYSGTAERMGR
2890|gene|hwa       LEDTIRSIEDYDGGIVATTFSSHVSRVSSLVEFAKDIDRQPVLLGRSMEKYSGAAERLGF
11920|hp|hbo        LEDVIRSVEDYDGGIVATTFSSHVSRVSSIVEFAKDIGRQPVLLGRSMEKYSGTAERLGF
2048|gene|hut       LKDVMYSMEDYDGGIVATTFSSHIARVKSLVEFADDIGRQPVLLGRSMEKYSGTAERLDF
3698|gene|nph       LKDVMYSLEDYDGGIVATTFSSHIARVKSLVEFAEDIGRQPVLLGRSMEKYSGTAERLDF
10080|gene|hma      LKDVMDSVADYDGGIVATTFSSHIARVKSLVEFADDIGRQPVLLGRSMEKYSGTAERLDF
837|gene|hhi        LKDVMDSVADYDGGIVATTFSSHIARVKSLVEFADDIGRQPVLLGRSMEKYSGTAERLDF
                    ::*.: *: **.***********::**.::**:* :*.*:*:*******.***:***:. 

2047|gene|hla       VDFQGDVGMYGHRKSVDRAFKRIMKEGKGNFLPIVTGHQGEPRAMLTRMGRGETPYEIEN
1149|chp|nrc1       VNFPDDLGMFGHRKSVDRAFKRVMNEGKENFLPIVTGHQGEPQAMLTRMGRGETPYDIED
2890|gene|hwa       VDLPDDVGMYGHRKSVDRTFKRIMKEGKENYLPIVTGHQGEPRAMLTRMGRGETPFELEN
11920|hp|hbo        VDFPDDVGMYGHRKSVDRTFKRIMKEGKENFLPIVTGHQGEPRAMLTRMGRGETPYEIEN
2048|gene|hut       VEFPEDLGMYGHRKSVDRTFKRIMSEGKENFLPIVTGHQGEPRAMLTRMGRGDTPYELEE
3698|gene|nph       VDFPSDLGMYGHRKSVDRTFKRIMDEGKEDYLPVVTGHQGEPRAMLTRMARGETPYELDE
10080|gene|hma      VDFPEDLGMYGHRKSVDRTFKRIMNEGKENFLPIVTGHQGEPRAMLTRMGRGETPYELDD
837|gene|hhi        VDFPEDLGMYGHRKSVDRTFKRIMNEGKENFLPIVTGHQGEPRAMLTRMGRGETPYELDD
                    *::  *:**:********:***:*.*** ::**:********.******.**:**:::::

2047|gene|hla       GDKVVFSASIIPEPTNEGQRYQSEQLLRMQGARLYDDIHVSGHLREEGHYEMLDALQPQH
1149|chp|nrc1       GDKIIFSASVIPEPTNKGQRYQSEQLLRMQGARIYDDIHVSGHLREEGHYQMLDALQPQH
2890|gene|hwa       GDKVIFSARVIPEPTNEGQRYQSERLLKMQGARIYDEIHVSGHLREEGHYQMLDALQPQH
11920|hp|hbo        GDKVIFSARVIPEPTNEGQRYQSERLLKMQGARIYDDIHVSGHLREEGHYQMLDALQPQH
2048|gene|hut       GDKVIFSARVIPEPTNEGQRYQSETLLKMQGARIYDEVHVSGHLNREGHYEMLNTLEPEH
3698|gene|nph       GDKVIFSARVIPEPTNEGQRYQAEKLLGMQGARIYDDIHVSGHLNSEGHYQMLQALNPTN
10080|gene|hma      GDKVLFSARVIPEPTNEGQRYQSEKLLGMQGARIYDDIHVSGHLREEGHYEMIDALQPKN
837|gene|hhi        GDKVIFSARVIPEPTNEGQRYQSEKLLGMQGARIYDDIHVSGHLREEGHYEMLDALQPKN
                    ***::*** :******:*****:* ** *****:**::******. ****:*:::*:* :

2047|gene|hla       LIPAHQTLKGRSPYVDLATSQGYKLGRDVHVTQNGSVIQLAE
1149|chp|nrc1       LIPAHQDMKGMAPYAKLAKSQGYKIGRDLHMTENGNTIQLVE
2890|gene|hwa       IIPAHQNLEGLSPYVDLAESQGYALGRDLHVTRNGNIVQLVG
11920|hp|hbo        VIPAHQNLKGFSPYVDLCESQGYDMGRDLHVTRNGNMIQLVE
2048|gene|hut       IIPAHQSMGGFAPYVELAESEGYELGEDLHVTRNGNVITLVE
3698|gene|nph       VIPAHQDMKGFSPYVELASNEGYELGRDLHVTKNGNTIQLTE
10080|gene|hma      IIPAHQSLEGFAPYVDLAENMGYKAGRDLHITRNGNMIKLTE
837|gene|hhi        VIPAHQSLEGFAPYVDLAENMGYKAGRDLHITRNGNMIQLTE
                    :***** : * :**..*. . **  * *:*:* **. : *.