HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0361COG2220KOG3798arCOG00497Predicted Zn-dependent hydrolases of the beta-lactamase foldhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0361 nrc1 VNG1038 vng1038 no entry
cHOG0361 hmu HMUK2759 Hmuk_2759 beta-lactamase domain protein
cHOG0361 hma RRNAC0300 hypothetical protein
cHOG0361 hwa HQ3368A hypothetical protein
cHOG0361 hla HLAC1346 Hlac_1346 hypothetical protein
cHOG0361 hbo HBOR19360 Hbor_19360 predicted Zn-dependent hydrolase of beta- lactamase fold
cHOG0361 hut HUTA2750 Huta_2750 beta-lactamase domain protein
cHOG0361 hvo HVO_1290 HVO_1290 metallo-beta-lactamase family protein
cHOG0361 nph NP2132A hypothetical protein
cHOG0361 hhi 1040 HAH_1040 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1346|hp|hla        MPSERNDAPSRTDRCRECDRAVTPGANFCPGCGADLRAAESRDDASAAYCTECGEPVAPA
2132|hp|nph        --------------------------------------MELTWYGHSTWHVSVGSTDLLI
3368|hp|hwa        --------------------------------------MELTWHGHSTWHVNVDGTTFLI
19360|hp|hbo       ------------------------------------MTMELTWHGHSTWHVDVDGTTFLI
1038|chp|nrc1      --------------------------------------MELTWFGHSTWRVTVGTTDLLV
10300|hp|hma       --------------------------------------MELTWYGHSTWHVTVDDTELLI
1040|hp|hhi        --------------------------------------MELTWYGHSTWHVTVDDTELLI
2750|gene|hut      --------------------------------------MELTWYGHSTWSVEVADTRLLI
                                                          *    . ::: .    .    

1346|hp|hla        AEFCANCGTRCGRAEPPTAGPPDPTADSDARREFRVRVRDHLDDGWELTEDHGDRVVLVA
2132|hp|nph        DPFFGN---------PKTDLEPSDLDSPD----YVLLTHGHEDHVAHAGAFSDATLVATP
3368|hp|hwa        DPFFSN---------PHTERKPTDIKKPD----YVLLTHAHADHIGDADVFTDTTVVGVP
19360|hp|hbo       DPFFDN---------PFTDLSPSDVEDPD----YLLLTHGHADHISDAGAFTDATVVGVP
1038|chp|nrc1      DPFFDN---------PHTDTAPSEVA-VD----HVLLTHGHADHIAHVGAFADTHTVGTP
10300|hp|hma       DPFFDN---------PHTDTDPEELG-PD----YVLLTHGHADHIGDVDRYEGCGLVATP
1040|hp|hhi        DPFFDN---------PKTDTDPEELD-PD----YVLLTHGHADHIGDVDRYEGCGLVATP
2750|gene|hut      DPFFDN---------PKTSLSPTDVERPD----FVLLTHGHADHIANVGAFPDATVVATP
                     *  *         * *   *      *    . : .. * *         .   * ..

1346|hp|hla        RDIGSIPAHVLLLLTTGGVGNLLYGWYNYAE-LAETRRLSVSDGPLPD---GELGAPGDG
2132|hp|nph        ELVGYAEDNFGFEDAVGGMGMNLGGSVECGDAWVTMTRADHSNGIETGYE-TSAGMPA--
3368|hp|hwa        EMTGYMESEVGF---TESIGMNIGGTVECGDAYVTMHRADHTNGLETDYE-YSIGVPT--
19360|hp|hbo       EMTGYMEAEVGF---TDSIGMNLGGTVECGNAFVTMHRADHTNGLNTGYE-HDIGMPA--
1038|chp|nrc1      EVTGYVADETGV---EDTTGMNLGGTVELGDAFVTMVRADHTNGLETGYE-YSGGTPV--
10300|hp|hma       EVVEYCKDNFGEFNAVGGMGMNLGGTVEIGDAFVTMHRADHTNGMETSYG-ASGGMPG--
1040|hp|hhi        EIVEYCEDNFGDFDAVGGMGMNLGGTVEIGDAFVTMHRADHTNGMETSYG-ASGGMPG--
2750|gene|hut      ELASYIEAEHG----NETVGMNLGGTVAAGEAFVTMHRADHTNGINTGYEIGSAGMPA--
                                      *  : *    .:  .   * . ::*  ..    . * *   

1346|hp|hla        DPLVALSGYLLGGILLLVGLGIAAVAVGQGARLGALFGLAFAALGLALSPPAERRLDRRH
2132|hp|nph        -------GFV--------------VSESEPQRASDAANTAFYHAGDT-------------
3368|hp|hwa        -------GYI--------------ISDNKPTRTADTDSTSFYHAGDT-------------
19360|hp|hbo       -------GFI--------------ISDKKPTQEADEDATTFYHAGDT-------------
1038|chp|nrc1      -------GYV--------------ISDAAPTQTGDGDATTFYHAGDT-------------
10300|hp|hma       -------GFI--------------ISDTKPTQVSDAESTTFYHAGDT-------------
1040|hp|hhi        -------GFI--------------ISDTKPTQVSDAESTTFYHAGDT-------------
2750|gene|hut      -------GFV--------------ISDAEPTRKSDDETTAFYHAGDT-------------
                          *::              ::     . .     :*   * :             

1346|hp|hla        GLSRFGRIRTVDHRITPSTERTEAPCVVCGEAFERGVVRRRRDETVVAGVPIRTHSLRCN
2132|hp|nph        -----SLMVEMREVIGPYLE-PDFAALPAGDHFTMGPEQ----AAIAADWLGADYAAPM-
3368|hp|hwa        -----GLMSEMKDVIGTYLE-PDAAALPTGDHFTMGPTQ----AAIAAEWLDVDHVFPM-
19360|hp|hbo       -----ALMSEMKDVIAQYLE-PDAAAVPCGDHFTMGPVQ----AAIAVDWLNVDHAFPM-
1038|chp|nrc1      -----SLQSEMKDVIGPYLD-PDAAAVPVGDHFTMGPMQ----AAVAVDWLDVDVAFPM-
10300|hp|hma       -----GLMTEMRDVIGPFLE-PDAAAVPVGDHFTMGPMQ----AAVAVDWLDVDHAFPM-
1040|hp|hhi        -----GLMTEMRDVIGPFLE-PDAAAVPVGDHFTMGPMQ----AAVAVDWLDVDHAFPM-
2750|gene|hut      -----GLMTEMRDVIAPFLE-PDAAAIPIGDHFTMGPEQ----AAVAVDWLDVEDAFPM-
                        .    :   *    : .: ..:  *: *  *  .     ::..            

1346|hp|hla        HYCAGCARAELFGGDADETAIDPDVSLDDSEFDDSEFDDSEFGRDEETERERERER
2132|hp|nph        HY-------DTFP----PIEIDTDEFVDALNATGADAEAVVLDGDESFTLG-----
3368|hp|hwa        HY-------DTFG----PIEIDINELVEEVGSGDTDATVHVLDGDETFIL------
19360|hp|hbo       HY-------DTFP----PVEIDIDDFEREVNATGSTAEVHVLDGDESFTLE-----
1038|chp|nrc1      HY-------DTFP----PIEVDTADFEREVNATGSQADVHVLDGDETVDLSDAL--
10300|hp|hma       HY-------DTFP----PIEIETQDFVNEVKGTGSDADVHVLDGDETFEL------
1040|hp|hhi        HY-------DTFP----PIEIETQDFVNEVKGTGSDAEVHVLDGDETFEL------
2750|gene|hut      HY-------DTFP----PIEQDAEAFAREVKAVGSDADVHVLDGDETFEL------
                   **       : *         :           .:      :. **