HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0360COG1201arCOG00557Lhr-like helicasesATP-dependent helicase

HOG Organism Gene ID Name Annotation
cHOG0360 nrc1 VNG1251 helA ATP-dependent helicase
cHOG0360 hmu HMUK2425 Hmuk_2425 DEAD/H associated domain protein( EC:3.6.1.- )
cHOG0360 hma RRNAC1139 yprA4 ATP-dependent helicase
cHOG0360 hwa HQ2752A lhr Lhr-like helicase
cHOG0360 hla HLAC0265 Hlac_265 DEAD/DEAH box helicase domain protein
cHOG0360 hbo HBOR19010 Hbor_19010 ATP dependent helicase, Lhr family( EC:3.6.1.- )
cHOG0360 hut HUTA0549 Huta_0549 DEAD/H associated domain protein
cHOG0360 hvo HVO_1333 HVO_1333 helA ATP-dependent helicase
cHOG0360 nph NP4002A lhr Lhr-like helicase
cHOG0360 hhi 1744 yprA3 ATP-dependent helicase/DEAD/H associated domain-containing protein
MUSCLE (3.6) multiple sequence alignment


1251|gene|nrc1      -MSET-G-GGRMDAFTHLGSEVRNALSERGFTTPTEPQRRAVPALADGRNGLVVAPTGTG
265|gene|hla        -MAE----LSGMDAFAHLGSELRTALSEQGFSTPTEPQREAIPPLADGKNALVLAPTGTG
2752|gene|hwa       -MADG-TATRGADVFSEFSAPVREALSERGFTTPTEPQRRAIPPLAHDRNALVIAPTGTG
19010|gene|hbo      -MADG-TAAQGMDAFTALGDTVRAALSERGFTTPTEPQRRAIPPLAAGKNALVIAPTGTG
4002|gene|nph       MMSEGHSAAAGMDAFARLHDDVRQALSERGFSTPTAPQRKAIPTLAAGESGLVVAPTGSG
549|gene|hut        -MSEA-T-REGDAVFAHLGDAVRSALSDRGFTTPTEPQRRAIPPIADGEDALVIAPTGSG
11139|gene|hma      -MTDG-V-ARGDDAFTALGPAVRSALSERGFTTPTDPQRKAIPTLADGRDALVVAPTGTG
1744|gene|hhi       -MTDG-V-ARGDDAFTALGPAVRSALSERGFTTPTDPQRKAIPTLADGRDALVVAPTGTG
                     *::         .*: :   :* ***:.**:*** *** *:*.:* . ..**:****:*

1251|gene|nrc1      KTETAMLPVFDALVSD-----GGPPDGFGALYVTPLRALNRDMRERLDWWGETLGLEVDV
265|gene|hla        KTETAMLPVFDAIVDARDAPGDQPRSGISALYITPLRALNRDMMDRLEWWGDRLGVEVAV
2752|gene|hwa       KTETAMLPVFDAIAES--DFDDSEREGFSALYITPLRALNRDMRDRLTWWGETLDIDIDV
19010|gene|hbo      KTETAMLPVLDSIVES----PDEDRAGLSALYVTPLRALNRDMRERLDWWGEELDIEVDV
4002|gene|nph       KTETAMLPVLSSIQER------PPRHGIQALYITPLRALNRDMRERLEWWGETLGIDIDV
549|gene|hut        KTETAMLPVFDAIEGD-------PPDGIAALYVTPLRALNRDMRDRLEWWGETLDLEIDV
11139|gene|hma      KTETGMLPVFDALAES------EDRFGIGALYITPLRALNRDMRQRLDWWGETLGLEVDV
1744|gene|hhi       KTETAMLPVFDALAES------EDRFGIGALYITPLRALNRDMRQRLDWWGETLGLEVDV
                    ****.****:.::             *: ***:********** :** ***: *.::: *

1251|gene|nrc1      RHGDTTDYQRRQQATDPPDVLVTTPETLQAMLTGSTLRDGLADVEHVVVDEVHELAGAKR
265|gene|hla        RHGDTTRYERSKQADDPPDVLITTPESLQAILTGSKMRVALEDVAHVVIDEVHELASAKR
2752|gene|hwa       RHGDTTQYQRRQQAEDPPDVLVTTPETLQAMLTGSKLRKALAGVDHVVVDEVHELAAAKR
19010|gene|hbo      RHGDTTQYQRQKQANDPPDVLVTTPETLQAMLTGEKLRTALSDVRHVVVDEVHELASAKR
4002|gene|nph       RHGDTTDYQRQKQAEDPPDVLVTTPETLQAMFTGEKLRRAIEDIEHIVVDEVHELAGSKR
549|gene|hut        RHGDTTQYRRQQQAEDPPDVLVTTPETVQAILTGEKLREGLADVAHVVVDEVHELAAAKR
11139|gene|hma      RHGDTTDYQRQKQANDPPDVLVTTPETLQAMLTGSKLRTALEDIEHIVIDEVHELAAAKR
1744|gene|hhi       RHGDTTDYQRQKQANDPPDVLVTTPETLQAMLTGSKLRTALEDVEHIVIDEVHELAAAKR
                    ****** * * :** ******:****::**::**..:* .: .: *:*:*******.:**

1251|gene|nrc1      GAQLAIGLERLVEVAGRVQRIGLSATVGDPHEIGAFLT----------GGRGCEIIEVDV
265|gene|hla        GAQLTVGLERLRRVAGPFQRIGLSATVGTPEEVGKFLVGSGKRDPDHPGDREFEIVEVAA
2752|gene|hwa       GVQLSVALERLQVLAGSFQRIGLSATVGSPTEVARFLT----------GDRPFEVIEIDA
19010|gene|hbo      GAQLTVGLERLRALAGPFQRIGLSATVGSPEEVGKFLT----------GDRSFEIVEVDA
4002|gene|nph       GAQLTVGLEHLREHAGPFQRIGLSATVGDPTEVGRFLT----------GDRGCHVTDVEA
549|gene|hut        GAQLTVGLERLRDLAGPFQRIGLSATVGDPAEVGRFLT----------GDRGCSIVEIDA
11139|gene|hma      GAQLTIGLERLRELSGRFQRIGLSATVGDPHEVGRFLT----------GGRTCAIVEVDI
1744|gene|hhi       GAQLTVGLERLRELSGRFQRIGLSATVGDPHEVGRFLT----------GGRTCAIVEVDI
                    *.**::.**.*   :* .********** * *:. **.          *.*   : ::  

1251|gene|nrc1      TSNVSFEVREPAVTDADERLASELLTTPAMASHVRAIREIVDRHDSVLIFVNTRQTAEAL
265|gene|hla        GTRTDVRVLDPPITDRDTTLAGELAVDETTASHVRTIREIVADHESTLIFVNTRQTAEAL
2752|gene|hwa       GSAIEFSVHHPTVTQKDEQLSRELATDETIASHVRVIRDIVSDHSSTLIFVNTRQTAEAL
19010|gene|hbo      GSKVAFTVVHPDVTREDQTLAGQLASEDEMASHVRAIRDIVRDHESTLVFVNTRQTAEAL
4002|gene|nph       GTNLDVTVRTPEIRPEDRTAAGELLTDAEVASHVRVIDELVDAHDSVLIFVNTRQTAEGL
549|gene|hut        GSDIEIDVVRPSIEERDENVAGEIVTDAEVASHVRQIDELIETHESTLVFVNTRQTAEAL
11139|gene|hma      GSRLDIEVVRPQITDRDEELSSSLVTDAGTASHVRFIADLIDENESVLLFVNTRQTAEAL
1744|gene|hhi       GSRLDIEVVRPQITDRDEELSSSLVTDAGTASHVRFIADLIDENESVLLFVNTRQTAEAL
                     :   . *  * :   *   : .:      ***** * :::  :.*.*:*********.*

1251|gene|nrc1      GSRFKELD------------ANIGVHHGSLSKDARIDVEDRFKSGDLDGLLCTSSMELGI
265|gene|hla        GSRFKTLAEREEKAGSIDDPTEIEVHHGSLSKDVRIDVEDRFKSGELDGLVCTSSMELGI
2752|gene|hwa       GSRFKKLG------------EPIEVHHGSLSKDVRIDVEDRFKNGSLDGLVCTSSMELGI
19010|gene|hbo      GSRFKRLN------------EPIAVHHGSLSKDVRIDVEDRFKTGELDGLICTSSMELGI
4002|gene|nph       GSRLKAYG------------TNIGIHHGSLSKSARIDVEDAFKTGEIDGLMCTSSMELGI
549|gene|hut        GSRLKEYG------------TDVGIHHGSLASDTRVEVEDAFKAGDLDALLCTSSMELGI
11139|gene|hma      GSRFKELG------------TDLGVHHGSLSKEARIDVEDRFKAGDLDALLCTSSMELGI
1744|gene|hhi       GSRFKELG------------TDLGVHHGSLSKEARIDVEDRFKAGDLDALLCTSSMELGI
                    ***:*                 : :*****:...*::*** ** *.:*.*:*********

1251|gene|nrc1      DVGGIDHVVQYNSPREVKRLLQRVGRAGHSRDAVSEGTVITGSTDDTLEALAVADRANEG
265|gene|hla        DVGRVDHVVQYGSPREVARLLQRVGRAGHRRDLVSEGTVVTQGGDDTLEALAIARRAGAE
2752|gene|hwa       DVGEVDHVVQYGSPREVARLLQRVGRAGHHRDRISHGTVITSSPDDTLEALAIARRATEG
19010|gene|hbo      DVGRVDHVVQYGSPREVSRLLQRVGRAGHRRDQTSRGTIVTSSADDTHEALAIARKAEAG
4002|gene|nph       DVGDIDHVIQYASPREVRRLLQRVGRAGHRRDETSSGTVITTHPDDTFEALSIVDRAERG
549|gene|hut        DVGRVDHVVQYNSPRQVSRLLQRIGRAGHRRDRTSAGTIVTTSPDETFEALAIARMARAG
11139|gene|hma      DVGHVDHVVQYGSPRQVSRLVQRVGRAGHRRDLVSSGTVVTTDTDDTLEALAIARQAEAG
1744|gene|hhi       DVGHVDHVVQYGSPRQVSRLVQRVGRAGHRRDLVSSGTVVTTDTDDTLEALAIARQAEAG
                    *** :***:** ***:* **:**:***** **  * **::*   *:* ***::.  *   

1251|gene|nrc1      AVEDTQVHHGSLDTVANQIVGVVMDVGETEAWHAYNIITRAYPFKQLTEETFRAVAMELH
265|gene|hla        LVEPAAIHHGSLDTVANQIVGVVMDEGDVHAREAYQIVTSAYPFRDLAEETFQEIVRELD
2752|gene|hwa       IVEPARIHHASLDTVANQIIGIVMDEGEVSARRAYQIVTAAYPFANLDKQTFREVIRELS
19010|gene|hbo      EVEPARIHHASLDTVANQIVGVVMDYGEVSARKTYELVTSAYPFCDLEAATFREIVRELS
4002|gene|nph       AVESAGIHHGSLDTVANQIAGLLMGFEELPAARAYEILTRAYPFRNLPEEQFKAVVRELS
549|gene|hut        EVEPAAIHHGSRDTVANQIAGVVMDLGEVDARRAYEIVTRAYPFGDISEAVFREIVRELA
11139|gene|hma      DVEPAEIHDGSLDTVANQIAGLVMDAGEIRAMRAYEILTRAYPFRDLDEAQFKQVVEELA
1744|gene|hhi       DVEPAEIHDGSLDTVANQIAGLVMDTGEIRAIRAYEILTRAYPFRDLDEAQFKQVVEELA
                     ** : :* .* ******* *::*.  :  *  :*:::* **** ::    *. :  ** 

1251|gene|nrc1      RNRVVYVDEDDDTISTSGGTWQYYYANLSMIPDEETYEVYDMAGGRQVGTLDERFVVNFA
265|gene|hla        GNHLLWLDEASDTLEKSGGTWQYFYANLSMIPDESTYEVYDMSSRRGIGTLDERFVVNFA
2752|gene|hwa       SNRLVWLEEDADRLEKSSGTWQYFYANLSMIPDEETYDVYDMSSRGQIGTLDERFVLNFA
19010|gene|hbo      GNRLLWLDEEKDVLEKSSGTWQYFYANLSMIPDEETYDVYDMSSRGQIGTLDERFVVNFA
4002|gene|nph       ENRILWLEEGDDRIEKSGGTWQYFYANLSMIPDEANYTVTDMASGDPVGTLAERFVVTFA
549|gene|hut        DNRVIWLEEDDDELSKRRGTWQYFYHNLSMIPDEATYDVADGTSGRQVGTLDERFVVNFA
11139|gene|hma      ANNVIWLDEDRDTLEKRRGTWQYFYQNLSMIPDEATYDVEDVASGQQVGTLDEKFVVNFA
1744|gene|hhi       ANNVIWLDEDRDTLEKRRGTWQYFYQNLSMIPDEATYDVEDVASGQQVGTLDEKFVVNFA
                     *.:::::*  * :..  *****:* ******** .* * * :.   :*** *.**:.**

1251|gene|nrc1      EPGATFVQRGEMWRITNIDEDDQQVEVSPIEDPAGEVPSWTGQEIPVPYAVAQAVGGMRA
265|gene|hla        GPGETFIQRGEMWRITEVDEEEERVNVTPIADPAGEVPSWIGREIPVPKPVAEEVGRIRG
2752|gene|hwa       EPGAAFIQRGEMWRINDIDDDETQVNVTPIEDPSGEVPSWTGAEIPVPAHVANEVGEMRA
19010|gene|hbo      EPGASFIQRGEMWRINDIDDEEGEVHVTPIEDPSGEVPSWTGSEIPVPAHVAGEVGEIRE
4002|gene|nph       EPGETFVQGGEMWRITEIDDEEEEVLVSPIEDPTGEVPSWVGQEIPVPRGVAEAVATARA
549|gene|hut        APGEVFIQAGEMWRITEIDEDEETVHVTPVGDPAGEVPSWTGQEIPVPYDVAQEVAELRG
11139|gene|hma      TPGEVFVQRGEMWRITNIDEEEEVVTVSPIEDPAGEVPSWVGQEIPVPRAVAAEVGELRR
1744|gene|hhi       TPGEVFVQRGEMWRITNIDEEEEVVTVSPIEDPAGEVPSWVGQEIPVPRAVAAEVGELRR
                     **  *:* ******.::*:::  * *:*: **:****** * *****  **  *.  * 

1251|gene|nrc1      TGGRQLGTGTPKDAVARDVAARYPTTHRTAGSALDRMARHVTEQDAPVPSAERIVVEQAG
265|gene|hla        EAAEALAAGSTPEAVAGDLAERYPADERTIATALKPVVDHV-DADHPVPTDRRIVIEGSA
2752|gene|hwa       AAAKQLATGANKEAVGRDLARRYPADVSTITSAIEPIERQI-IGEYPIPTADRLVIEAQA
19010|gene|hbo      TAARQFELGGERDAVARDFRGRYPTDERTVSKSLKPTERQV-DAELPVPTADRLVIEGQG
4002|gene|nph       DARGRFDGGDGRGAVARSVADRYPTDEHTASEALKPVEAH----KGPIPTPDRIVVEGFG
549|gene|hut        VAAEQLRAGGEPESVARHLAGRYDAAEATIRSALEQIEYH----EGPVPGPNRIVVEFEG
11139|gene|hma      VAGRQLQDGADTEAVARDVATRYAAGPETVVDGLSQVEEH----EGPIPDDTTILVEFHG
1744|gene|hhi       VAGRQLQDGADTEAVARDVATRYAAGPETVAEGLSQVEKH----EGPIPDDTTILVEFHG
                     .   :  *    :*.  .  ** :   *   .:.    :    . *:*    :::*  .

1251|gene|nrc1      STVVVNACFGHEVNETLGRLVSALLGQQTGSSVGLDAGPYRIELEVPSRVSATDVVAVLR
265|gene|hla        RTVAVNAAFGHEVNETLARLLAALVGQRAGSSIGMDVDPYRIEFEVPHGVGPGTFREVLE
2752|gene|hwa       QTVVINSPHGHRINETLGRLLAALVGQRTGASVGLDVSPYRIELELPRQASIGDVTAVFD
19010|gene|hbo      RKVTLNSPYGHRVNETLGRMLAALVGQRTGSSIGIETDAYRVTFEVPPNASVHDFTEVLE
4002|gene|nph       RQIVLNAAFGHTANETLGRLLSALIGQQTGGSVAMEVDPYRIELEVPSGTSIGDVVELLE
549|gene|hut        RDVVLNAAFGHKVNETLGRLLSALLGQRTGSSVGLDVDPYRISLEVPRNVTAGDVVDVLE
11139|gene|hma      REVIVNACYGHKINETLGRVLSALLGQRAGSSVAMDVDPYRITLEVPRRITAGDVIEVIE
1744|gene|hhi       REVIVNACYGHKINETLGRVLSALLGQRAGSSVAMDVDPYRITLEVPRRITAGDVIEVIE
                      : :*: .**  ****.*:::**:**.:*.*:.::...**: :*:*       .  :: 

1251|gene|nrc1      DTDPDHVAGLLELSLKQSETLKFTLAQVAAKFGALKRWK-GR----DGVGLSRLLGALEG
265|gene|hla        TTDPDRLEAYLELALKNSDALKFTLAQVAAKFGSIKRYREGR----GRFGGDRLLAALEG
2752|gene|hwa       ETDPMHVEAILELALKKADALKFTLAQVAAKFGALKRYQ-GR----ERFGGDRLMAALED
19010|gene|hbo      TTDPDHVEGVLELALKHSESLKFTLAQVAAKFGALKRYQ-GN----KRFGGDRLLAALED
4002|gene|nph       TTDPDHVPTLVELSLKNAETLKFTLAQVAAKFGALKRWK-GTGSSQNRFGKDRLLAALED
549|gene|hut        STDPAHVEGLIELSLKNAGALKFRLAQVATKFGALKNWR-GRGS--NRFGRDRLLEALEG
11139|gene|hma      DTDPDHLPALIELSLKNADALKFKLAQVATKFGSLKRWR-GRGS--TDFGRDRLLAALED
1744|gene|hhi       DTDPDHLPALIELSLKNADALKFKLAQVATKFGSLKRWR-GRGS--TDFGRDRLLAALED
                     *** .:   :**:**:: :*** *****:***::*.:. *       .* .**: ***.

1251|gene|nrc1      TPVYEEAIREVFHTTLDVARASDVLARVQSGELGVEIVGERTAVGAGGRSAGTELLTPEH
265|gene|hla        TPVYDEALREVFHADLAVGETAELLEDVQDGSIDLAIARERTPLGIAGRSSGTEFLVPEN
2752|gene|hwa       TPVYDEAVREVFHTDLAVPETTALLERYHTDELTIATTRERTPIGVDGRSHGKELLVPSN
19010|gene|hbo      TPIYDEAVREVFHVDLAVPETTELLRKIQDGEVALETARERTPIGIDGRSSGRELLVPEN
4002|gene|nph       TPIYDEAVRVVLHEQLDVDGASDILSRLQSGDIELATVGERTALGQAGRSSGRELLSPEN
549|gene|hut        TPIYDEALRELIHEKLDIDRASELLREIQSGDIVVETVGGRTAIGRGGRSGSKELLAPEN
11139|gene|hma      TPMYDEALREVRHEDLAIEATADLLRDIQNGDVALETVGEHTPIGTGGSSSGRELLSPEN
1744|gene|hhi       TPMYDEALREVRHEDLAIEATADLLRDIQRGDVALETVGEHTPIGTGGSSSGRELLSPEN
                    **:*:**:* : *  * :  :: :*   : ..: :  .  .*.:*  * * . *:* *.:

1251|gene|nrc1      ADASVVQTIKDRIQDDRVKLFCVHCADWSHETMVRRVTDQPECPRCGSTRIAALSPWADE
265|gene|hla        ADADVIETIRERIRNDRVILFCLHCADWKRTTKVRRVPDQPKCPDCGSTRVATLNPWDEE
2752|gene|hwa       ADAGVIEAVRDRIQDDNVRLLCLHCTDWEQKKPVRRVRDQPRCPRCEATRIACLNPWDED
19010|gene|hbo      ADASVIQAIKERIQNDRVILQCLHCTDWKTTRKVRRVRDQPECPECGATRVACLNPWDDE
4002|gene|nph       ADASVVETVKERILDDDVLLACLHCKEWDRRQTVKRVDDQPECPLCGSTRIAALNPWADE
549|gene|hut        ADASVIQTLKDRIQEDRVILFCVHCESYKTTKPVKRVRDQPKCPECGSTRIAALNPWDEE
11139|gene|hma      ADASVIKTVKERIQSDRVILACLHCKKWDRKQQVKRVRDQPSCPQCGSTRIAALNPWAEE
1744|gene|hhi       ADASVIKTVKERIQSDRVILACLHCKEWDRKQQVKRVRDQPSCPQCGSTRIAALNPWAEE
                    ***.*::::.:** .* * * *:** .:.    *.** *** ** * :**:* *.** ::

1251|gene|nrc1      VITAVRAD--DKDDEQDDRTQRAYRNASIVQSHGKRAVIALSARGVGPRNAARVINRHRE
265|gene|hla        TVTAVRAT--EKDEEQERRTKRAHRAASLVQTHGKRAVIALAARGVGPHNAARIINKLRE
2752|gene|hwa       TPKAVRGGTLEEDTDADRLQRRAHRSASLIQSHGKQAAIALAARGVGPQTAARIIGNLRE
19010|gene|hbo      TVTAVRAN--DPDDEQRRLKKRAYKSASLVQSHGRKAVVALAARGVGPQNAARIIGKLRE
4002|gene|nph       VLEAVRTD--DKDDDQQKATERAYKAASIVQSHGKRAVIALAARGVGPRNAAYIINNHRE
549|gene|hut        TVTAVKTD--EKDDEQERRTKRGYQAADLVQSHGKQAIIALAGRGVGPTNAARIINKLRE
11139|gene|hma      VVSAVRTD--DKDEEQEKMTERAYRSASLVQSHGKQAVVALAARGVGPHNAARIINRLRE
1744|gene|hhi       VVSAVRTD--DKDEEQEKMTERAYRSASLVQSHGKRAVVALAARGVGPHNAARIINRLRE
                    .  **.    : * :      *.:. *.::*:**..* :**:.***** .** :*.. **

1251|gene|nrc1      TEAEFYRDILEREREYARTKAFW-
265|gene|hla        DEDEFYRDVLRQEREYARTQSFWD
2752|gene|hwa       DETEFYRDILKQEQQYARTQSFWD
19010|gene|hbo      DEDDFYRDILEQERQYARTQSFWD
4002|gene|nph       EEADFYRDIIERERQYARTKSFWD
549|gene|hut        NEDDFYRDILAREREYARTRSFWE
11139|gene|hma      DEDEFYRDILRQEREYARTQSFWG
1744|gene|hhi       DEDEFYRDILRQEREYARTQSFWG
                     * :****:: .*.:****.:**