HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0036COG0649 COG0852arCOG01548NADH dehydrogenase/oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0036 nrc1 VNG0637 ndhG5 NADH dehydrogenase/oxidoreductase
cHOG0036 hmu HMUK0188 Hmuk_0188 NADH-ubiquinone oxidoreductase chain 49kDa( EC:1.6.5.3 )
cHOG0036 hmu HMUK1919 Hmuk_1919 NADH-ubiquinone oxidoreductase chain 49kDa( EC:1.6.5.3 )
cHOG0036 hma RRNAC1449 ndHG5 NADH dehydrogenase/oxidoreductase
cHOG0036 hma RRNAC2023 nuoC NADH dehydrogenase I chain C D
cHOG0036 hwa HQ1639A nuoCD NADH dehydrogenase, subunit Cd (ubiquinone)
cHOG0036 hla HLAC0706 Hlac_706 NADH-ubiquinone oxidoreductase chain 49kDa
cHOG0036 hbo HBOR21450 Hbor_21450 NADH dehydrogenase subunit C /NADH dehydrogenase subunit D (EC 1.6.5.3)( EC:1.6.5.3 )
cHOG0036 hbo HBOR26570 Hbor_26570 NADH dehydrogenase subunit C /NADH dehydrogenase subunit D (EC 1.6.5.3)( EC:1.6.5.3 )
cHOG0036 hut HUTA0704 Huta_0704 NADH-ubiquinone oxidoreductase chain 49kDa
cHOG0036 hvo HVO_0968 HVO_0968 ndhG nadh-quinone oxidoreductase chain c/d
cHOG0036 nph NP2296A nuoCD NADH dehydrogenase-like complex, subunit Cd
cHOG0036 hhi 2526 nuoCD2 NADH dehydrogenase subunit CD (ubiquinone)
cHOG0036 hhi 2030 nuoCD1 NADH dehydrogenase subunit CD (ubiquinone)
MUSCLE (3.6) multiple sequence alignment


26570|gene|hbo      MSLDTRSRELADEAGTD-------G--LDTLLSDLLLSRDDHVHAPGFVVRPDNVQETLR
12023|gene|hma      -MAQTVHRTDDVH-----------P--LIEPIADHVLSTERHENAPAAVIRADEVQTVLS
2526|gene|hhi       -MAQTVHRTDDVH-----------P--LIEPIADHVLSTERHENAPAAVIRADEVQTVLS
637|gene|nrc1       MSTQQEDDTPDVDDAAPATPASGSPAALEALIEDHVLEREDHLNAPGFVIRADAVQDVLS
2296|gene|nph       MSLQEPASDIGET---ADGEVDYAE--LEALLGEHVIDREEHVNAPAFVVRPDEVQDVLF
704|gene|hut        MSLQERSPAEP-DVGVTEDGLDYDE--LADLLGDHVLDREEHVNAEGFVIRPDEVEDVLS
11449|gene|hma      MSLEKPSRDTALDVGVTEDGLDYDA--LADLLGGHVLDREEHVNAEGFVIRPDEVQEVLS
2030|gene|hhi       MSLEKPSRDTALDVGVTEDGLDYDA--LADLLGGHVLDREEHVNAEGFVIRPDEVQEVLS
706|gene|hla        MSLERPDSVDDGAG-----ERTPDE--LEALLGDLVVDRDDHLNAPGFVIRPDTVQETLS
1639|gene|hwa       MSLEEPEPTQSAEKTAEQLPTTGDE--IESLLSDVVIGRDDHLNAPGVIIRPDDVQKTLR
21450|gene|hbo      MSLEKPQDRTQSEALAAK-PTTGDE--IAELLGDLVIGREEHVNAPGFVIRPDDVQETLF
                       :                       :   :   ::  : * :* . ::*.* *: .* 

26570|gene|hbo      RLRDEAGFDHLSCVTAQEYEDRYETIYHMKSYDDPTDEVSIVVPTPSNAPVSESGAPVFE
12023|gene|hma      TLRTEAGLDHCACVTAQEYADRFETIYHLRRYADPTQELSVVVPTARESPTSESAVPVYP
2526|gene|hhi       TLRTEAGLDHCACVTAQEYADRFETIYHLRRYADPTQELSVVVPTARESPTSESAVPVYP
637|gene|nrc1       TLKTEAGFDHLSCVTAEEHEDRFESIYHLRKYDDPTQEVSIIVPTSRDNPVSETAEPVFR
2296|gene|nph       ALRDEAGFDYLSNVTAQEYEDRYESIYHLKKYDDPTQEVGVVVPAAKGEPVSQTAEPVYR
704|gene|hut        TLKERAGFDHLSAVTAQEYDDRYESIYHLKKYDDPTQELSVVVPTSSEEPVSQSGASVFD
11449|gene|hma      TLKEEAGFDHCACVTAQEYDDRYESIYHLRKYNDPTQELSIVVPSPKDDPHNESAARVYD
2030|gene|hhi       TLKEEAGFDHCACVTAQEYDDRYESIYHLRKYNDPTQELSIVVPSPKDDPHNESAARVYD
706|gene|hla        ILKEQAGYDHLSVVSAQEYENRYESIYHLKKFDDPTQEVSVVVPADKDDPVSESAEPVFR
1639|gene|hwa       RLRNKAGFDHLSCVTADERVDRYESIYHLTSYDDRTRELSVVVPTTKDDPVSESAAPVFR
21450|gene|hbo      RLRDEAGFDHLSCVTAEEREDRYESIYHLTSYDDRTREVSVVVPAAKDNPHSQSGNAVFR
                     *.  ** *: : *:*:*  :*:*:***:  : * * *:.::**:    * .::.  *: 

26570|gene|hbo      TAGWHEREAYDLVGIEYDDHPDLRRILLPETWQGHPLSRDYDQDRPQIVPYREHANPIED
12023|gene|hma      TAAWHEREAYDLVGIEYEDHPDLRRILLPETWQGHPLSRDYNQDQPQIVSFREHERLLED
2526|gene|hhi       TAAWHEREAYDLVGIEYEDHPDLRRILLPETWQGHPLSRDYNQDQPQIVSFREHERLLED
637|gene|nrc1       TADWHEREAYDLVGVEYDDHPNLERILLPDTWQGHPLGLDYNQNKPQIVTFDEHKNPLEG
2296|gene|nph       TADWHEREAYDLVGIEYEGHPDMRRILLPETWQGHPLGLDYDPEKPQVVPFREHKNPLQP
704|gene|hut        TADWHEREAYDLVGIEYDEHPDLRRILLPETWQGHPLSNEYNQTQPQVVTLREHANPLQE
11449|gene|hma      TADWHEREAYDLVGIDYDDHPDLRRILLPETWQGHPLSQDYNQDQPQIVSLREHANPLKD
2030|gene|hhi       TADWHEREAYDLVGIDYNDHPDLRRILLPETWQGHPLSQDYNQDQPQIVSLREHANPLKD
706|gene|hla        TADWHEREAYDLIGIEYDDHPDLRRILLPETWQGHPLSMDYDQDRPQIASLPEHANPLQE
1639|gene|hwa       TADWHEREAYDLIGINYEDHPDLRRILLPQTWQGHPLSNNYDQDRPQIVTLKEWENPLAE
21450|gene|hbo      TADWHEREAYDLVGIEYDDHPDLRRILLPETWQGHPLSMDFDQDRPQVVTLKEWANPLKD
                    ** *********:*::*: **:: *****:*******. :::  .**:..  *. . :  

26570|gene|hbo      DSR---DGDTLFLNVGPHHPATHGVLHLKVTLDGEHVVDLDPEIGYIHRCEEQMCQSKTY
12023|gene|hma      HRA---GPETMHINMGPHHPSTHGVLHLNVQLDGEQVAAVDPDIGYIHRCEEQMCQQGTY
2526|gene|hhi       RRE---GPETMHLNMGPHHPSTHGVLHLNVQLDGEQVAAVDPDIGYIHRCEEQMCQQGTY
637|gene|nrc1       HEQAADDSDTMFLNIGPHHPATHGVLHVETVLDGEQVADVNPDIGYLHRCEEQMAQKGTY
2296|gene|nph       DEH-SAESDTMLLNVGPHHPATHGVLHVKAVLDGEQIADVEPDIGYLHRCEEQMCQQSTY
704|gene|hut        DKQSPQDPDTMFVNIGPHHPATHGVLHVKTVLDGEQIVDLDPDIGYLHRSEEQMCQQGTY
11449|gene|hma      DKRSEDDPDTMFVNIGPHHPATHGVLHVETVLDGEQIADLEPDIGYLHRCEEQMCQQGTY
2030|gene|hhi       DKRSEDDPDTMFVNIGPHHPATHGVLHVETVLDGEQIADLEPDIGYLHRCEEQMCQQGTY
706|gene|hla        HHK-DAESDTMFLNIGPHHPATHGVLHLKTVLDGEQVVDVEPDIGYLHRSEEQMAQSGTY
1639|gene|hwa       DHR-EEEGDTMYINIGPHHPATHGVLHVKTVLDGEQIADIDPDIGYLHRCEEQICEAKTY
21450|gene|hbo      DHR-DSEGDTMYLNIGPHHPATHGVLHVKTVLDGEQVAHVEPDIGYLHRCEEQMCQTKTY
                            :*: :*:*****:******::. ****::. ::*:***:**.***:.:  **

26570|gene|hbo      RHQIMPYPDRWDWGGGGLLNEWAYARTAETLADIDVPEYAQVIRTMTAELSRMLSHFLSI
12023|gene|hma      RHQIMPYPDRWDWGGAGLLNEWAYARAAEALADIEVPAYAQVIRTMGGELSRILSHMLAV
2526|gene|hhi       RHQIMPYPDRWDWGGAGLLNEWAYARTAEDLADIEVPAYAQVIRTMGGELSRILSHMLAV
637|gene|nrc1       RHQIMPYPDRWDYGPGGILNEWAYARTAEDLADIDVPEYAQILRTMGGELCRIACHMLAL
2296|gene|nph       RHQIMPYPDRWDYVSAGILNEWAYARAAEDMADIEVPEYAQVIRTMSAELCRIASHMLAL
704|gene|hut        RHQIMPYPDRWDYTPGGLLNEWAYARAAEDLADIDVPEYAQVLRTMSAELTRIAAHMLAV
11449|gene|hma      RHQIMPYPDRWDYISAGILNEWAYARAAEDLADIDVPEYAQVIRTMSAEMCRIASHELAL
2030|gene|hhi       RHQIMPYPDRWDYISAGILNEWAYARAAEDLADIEVPEYAQVIRTMAAEMCRIASHELAL
706|gene|hla        RHQIMPYPDRWDYISAGLLNEWAYARAAEDLADIEVPEYAQVIRTMGAEMCRIAAHMLAL
1639|gene|hwa       RHQIMPYPDRWDYASSGLLNEWAYARAAEDLNDLEVPEYAQVIRTMGAEICRIASHMLAV
21450|gene|hbo      RHQIMPYPDRWDYASSGLLNEWAYARAAEDLNDIDVPEYAQIIRTMGAELCRIASHMLAV
                    ************:  .*:********:** : *::** ***::*** .*: *: .* *::

26570|gene|hbo      GAYALDVTGDFTATFMYAIRDREQIQNILEDVTGQRLMFNYFRLGGVVWDLPEPREEFFE
12023|gene|hma      ATYALDVVGEFTATFQWGVRDRELVQDILEDLTGQRLMFNYLRLGGVAWDLPEPREAFFE
2526|gene|hhi       ATYALDVVGEFTATFQWGVRDRELVQDILEDLTGQRLMFNYLRLGGVAWDLPEPREAFFE
637|gene|nrc1       GTFCLDIYGDFTAIFMYAMRDREVVQNILEDLTGQRMMLNYLRLGGVVWDIPEPRAEFFE
2296|gene|nph       GTFALDVFGDFTAVFQYAFRDREVVQNILEDLTGQRLMFNYLRLGGVAWDVPEPREAFFE
704|gene|hut        GTFGLDLYGDFTVIFMYAVRDREVVQNLLEDLTGQRLMFNYFRLGGVAWDLPEPRQEYLE
11449|gene|hma      ATFALDVFGDFTAVFQYGIRDREIVQNLLEDLTGQRLMFNYLRLGGVAWDLPEPREEYFE
2030|gene|hhi       ATFALDVFGDFTAVFQYGIRDREIVQNLLEDLTGQRLMFNYLRLGGVAWDLPEPRDEYFE
706|gene|hla        ATFALDINGDFTATFMYAINDRERVQNLLEDLTGQRLMFNYFRLGGVVWDLPEPRDEFFS
1639|gene|hwa       GTFALDVYGDFTAIFMYAMRDREKAQNILEDLTGQRMMFNYFRLGGVVWDLPEPRDEFFE
21450|gene|hbo      GTFALDVYGDFTAIFMYAMRDREIIQNILEDLTGQRMMFNYFRLGGVVWDLPEPREEFFE
                    .:: **: *:**. * :...***  *::***:****:*:**:*****.**:****  ::.

26570|gene|hbo      KVYNFVDGLPQKLAEYHDLLTGNEVLQLRSVDTGILPAEVAKSYGCTGPVARGSGIEYDL
12023|gene|hma      KIRAFLDDLPHKLTEYHDMLTSNEILQLRTIDTGHLSAETAKAYGCTGPVARASGVDYDL
2526|gene|hhi       KIRAFLDDLPHKLTEYHDMLTSNEILQLRTVDTGHLPAETAKAYGCTGPVARASGVDYDL
637|gene|nrc1       SVRDFLDELPERLDEYSDLITSNEIFQARTVNTGVLDYETAKDYGVTGPVARGSGVDYDV
2296|gene|nph       KIRDFLDDLPEKTKEYHNLITSNEIFQARCVNTGELPPAVAKQYGATGPVARGSGIDIDL
704|gene|hut        KVREFTDELPERLEEYHDLITGNEIFQMRCIDTGVLPPEVAKSYGATGPVARGSGVDYDL
11449|gene|hma      KIRDFLDDLPHKLEEIHDLVTGNEIFQMRCVDTGVLSPDQVKQYGATGPVARGSGVDYDI
2030|gene|hhi       KIRDFLDDLPHKLEEIHDLVTGNEIFQMRCVDTGVLSPEQVKQYGATGPVARGSGVDYDI
706|gene|hla        KTRDFLDHLPESVEEYHNLITSNEIFQMRTIDTGILPPEVAKNYGATGPVARGSGVDYDL
1639|gene|hwa       TIRDFLEDLPTALEEYHDLISSNEILQVRTIDTGVLPPEEAKSYGATGPVARGSGIDYDL
21450|gene|hbo      KIRDFLDDLPTALEEYHDLISSNEILQVRTIDTGVLPPEVAKSYGATGPVARGSGIDYDL
                    .   * : **    *  ::::.**::* * ::** *    .* ** ******.**:: *:

26570|gene|hbo      RRDDPYGYYNELDWNVVTEPDGDNFSRLLVRMREIEESARIVEQCAELLADWPEDDRTIQ
12023|gene|hma      RRDDPYGYYDELDWSVVTEQGGDNFSRLLVRLREVEESAKIIGQCVDLLEDWPEDDREIQ
2526|gene|hhi       RRDDPYGYYDELDWSVVTEQGGDNFSRLLVRLREVEESAKIIRQCVDLLEDWPEDDREIQ
637|gene|nrc1       RRDDPYGYYPELDWDVVTEDGGDNYSRLLVRMEEVEQSARIIEQCVDLLEGWPEDERDIQ
2296|gene|nph       RRDDPYGYYEELDWDVVTEDGCDNYSRVLVRMREVEESAKIIEQCVDLLEEWPEDDREIQ
704|gene|hut        RRDDPYGYYDELDWDVVTEDGMDNYARVLVRLQEVEESAKIIRQCLDLLEDWPEDDRTIQ
11449|gene|hma      RRDDPYGYYDELDWNVVTEQGGDNFSRVLVRLREVEESARIIEQCVDLLEQWPEDDREIQ
2030|gene|hhi       RRDDPYGYYDELDWNVVTEQGGDNFSRVLVRLREVEESARIIEQCVDLLEQWPEDDREIQ
706|gene|hla        RRDDPYGYYDELDWDVITEDGCDNFSRLLVRMREVEESAKIIEQCVDLLEDWPEDERNIQ
1639|gene|hwa       RRDDPYGYYDELDWDVVTEDGCDNFSRLLVRLREVEESAKIIEQCVDILEGWPEDERTIQ
21450|gene|hbo      RRDDPYGYYDELDWDVVTEDGCDNYSRLLVRMREVEESAKIIQQCVDLLEDWPEDERTIQ
                    ********* ****.*:** . **::*:***: *:*:**.*: ** ::*  ****:* **

26570|gene|hbo      SNVPRTIRPDDDTEVYRAVEGAKGELGIYIRSDGTEKPARFKIRGPSFSNLQALPEIAEG
12023|gene|hma      ANVPRTLRPDPDTEIYRAVEAAKGELGIYIRSDGTETPARFKIRGPSFSHVQALSEMARG
2526|gene|hhi       ANVPRTLRPDPDAELYRAVEAAKGELGIYIRSDGTETPARFKIRGPSFSHVQALSEMARG
637|gene|nrc1       ANVPRTLKPEAGTETYRTVEGAKGELGVYIRADGTEKPGRFKIRSPCFSNLSALKEMSTG
2296|gene|nph       SNVPRTLKPDPDTEVYRGVEAAKGELGIYMRADGTDKPARFKIRSPCFCNLHTLREMTEG
704|gene|hut        SNVPRTLRPDPDKEVYRAVEGAKGELGIYIRSDGTDKPARFKIRSPCFSNLQTLPVMSEG
11449|gene|hma      ANVPRTLRPDPDKEIYRSVEGAKGELGIYIRSDGTDKPARFKIRSPCFSNLQTLPEMSQG
2030|gene|hhi       ANVPRTLRPDPDKEIYRSVEGAKGELGIYIRSDGTDKPARFKIRSPCFSNLQTLPEMSQG
706|gene|hla        ANVPRTLRPDDDTEIYRAVEGAKGELGIYIRADGTDKPARFKIRSPCFSNLQTLPEMANG
1639|gene|hwa       SNVPRTLRPDDDAEIYRAVEGAKGELGIYIRGDGTEEPGRFKIRSPCFSNLQTLPEMSSG
21450|gene|hbo      SNVPRTLRPEDDKEIYRAVEAAKGELGIYIRGDGTDKPGRFKIRSPCFSNLQTLGEMSNG
                    :*****:.*: . * ** **.******:*:*.***: *.*****.*.*.:: :*  :: *

26570|gene|hbo      GLIPDLIASLGSLDTIMGEVDR
12023|gene|hma      EYVPDLVATIGSLDTIMGEVDR
2526|gene|hhi       EYIPDLVATIGSLDTIMGEVDR
637|gene|nrc1       EYIPDLVATLGSLDVILGEVDR
2296|gene|nph       EYIPDLIASLGSLDIVLGEVDR
704|gene|hut        EYIPDMVASLGSLDIVLGEVDR
11449|gene|hma      EYIPDMIASLGSLDIVLGEVDR
2030|gene|hhi       EYIPDMIASLGSLDIVLGEVDR
706|gene|hla        EYIPDVVAALGSLDIVLGEVDR
1639|gene|hwa       EYIPDMVASLGSLDIVLGEVDR
21450|gene|hbo      EYIPDMIASLGSLDIVLGEVDR
                      :**::*::**** ::*****