HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0358COG0110KOG4750arCOG01850Acetyltransferase (isoleucine patch superfamily)acetyltransferase homolog

HOG Organism Gene ID Name Annotation
cHOG0358 nrc1 VNG1385 yvoF acetyltransferase homolog
cHOG0358 hmu HMUK2317 Hmuk_2317 galactoside O-acetyltransferase 3; maltose O-acetyltransferase 3( EC:2.3.1.79 )
cHOG0358 hma RRNAC1106 hypothetical protein
cHOG0358 hwa HQ2561A acetyltransferase-like protein
cHOG0358 hla HLAC1294 Hlac_1294 galactoside O-acetyltransferase 3; maltose O-acetyltransferase 3
cHOG0358 hbo HBOR15550 Hbor_15550 acyltransferase family protein( EC:2.3.1.79 )
cHOG0358 hut HUTA0299 Huta_0299 acetyltransferase-like protein
cHOG0358 hvo HVO_1658 HVO_1658 acetyltransferase homolog
cHOG0358 nph NP4198A maa_3 galactoside O-acetyltransferase 3; maltose O-acetyltransferase 3
cHOG0358 hhi 1715 wbbJ galactoside O-acetyltransferase 3; maltose O-acetyltransferase 3
MUSCLE (3.6) multiple sequence alignment


11060|hp|hma        ----------MNNRTLNDSGT-YTDKLTEQDVLKAFDY---ETTAEAPM-----------
299|gene|hut        ----------MSDDITS-----RHERLDRHDVPGPRNALRHWIKTRNPLWMLVVPAIIWV
1294|gene|hla       MTHEDERLGAAETDATESDGH-RGDRLERHPTPGPRNSLWSWPNAKSPLAVVRNYVVIVL
1715|gene|hhi       -------MITAAPYTTDVSGP-RHDRLRQHPTPGPHNSLFPWPDAKHPLRVMVNYVVILV
1385|gene|nrc1      ----------MTARPDSSGASSRHDRLQRHPTPNARNSLWRWTDAKHPLRVALNYVVIVL
4198|gene|nph       -----MTDAADSPADDDTAGERRHDRLRRHATPGPRNSLWSWPEAKHPLRVALNYVVIVL
2561|gene|hwa       ----------MTD---------RHRRLDRSSTPGSTNSLWKWTDAKPVWIVIRNYIFIMF
15550|gene|hbo      ----------MSDDTDDAAGR-RHHRVQGHPTPGPLNSLQYWTDAKPVWRVALNYILVWV
                                             .:    .  . :       :               

11060|hp|hma        -------------LTASEITDAVAEHFDTEVSSETVRRRLREMEDSELVA------SKEF
299|gene|hut        LRLVPSVRIKNVVLRLLGAEVGEGVALAMGATPDMLWPDLLEIEDDAIVGYDATLLCHEY
1294|gene|hla       ARICPSLRLKNWLLRRIGVTVGAGVAWGLESTPDVFWPERITVEDDAIIGYDATLLCHEF
1715|gene|hhi       CRISPSLRLKNWLLSRLGVTVGDSVAWGLESTPDVFWPELITVEDHAIIGYDATLLCHEF
1385|gene|nrc1      ARISPSLHAKNWLLARIGVTVGDGVAWGLESTPDVFWPELVTVGDDAIIGYDATLLCHEF
4198|gene|nph       ARHSPSLRLKNWLLRRIGVTVGTGVSWGLESTPDVFWPELVTVDDDAVIGYDTTLLCHEF
2561|gene|hwa       ARLVPSLRARNWALRQLGAHIGSGVSWGLEATPDVFWPELITIEDNAIIGYDAVLLCHEF
15550|gene|hbo      ARVAPLLRWKNWALRRLGVTVGSGVSWGLEATPDVFWPELVTLGDDVIVGYDSVILCHEF
                                 *       . .       :.: ..     : *  ::.      .:*:

11060|hp|hma        -------GASAAGWTPLVGPR--------------------LSDDV-----LANIEATES
299|gene|hut        LQDEYRTGTVVVGERAMIGASAVVLPGVRIGADAQVAANSLVSEDVPPGVTVAGVPAEVV
1294|gene|hla       LQDEYRLGDVVVEDRAMIGAGAIVLPGVTVGEGARVAANSLVAEDVPPGTTVAGVPAEVV
1715|gene|hhi       LQDEYRTGEVVVGERAMIGAGAIVLPGVEIGPGAQVAANSLVTADVPPETTVAGVPAEPL
1385|gene|nrc1      LHDEYRTGAVVVEDRAMIGAGAVVLPGVTIGADAQVAANSLVTADVPPGETVAGVPAAPT
4198|gene|nph       LQDEYRTGQVRIGRRAMVGAGTIVLPGVEIGDGAQVAANSLVTEDVPPGETWAGVPAEPV
2561|gene|hwa       LQDEYRTGEIVIGKRAMVGAKVTILPGVHIGEEAQVAANSLVTQDVPPHTTVAGVPAQQM
15550|gene|hbo      LQDEYRTGEVVIGDRAMIGAKAVILPGVHIGEDAQVAANSLVTRDVPPGTTVAGVPARPM
                           *       .::*.                     :: **      *.: *   

11060|hp|hma        EL------------------
299|gene|hut        SRPEETSGTTDESSPEAGDA
1294|gene|hla       SQADAEREERREDND-----
1715|gene|hhi       GADDETTEEA----------
1385|gene|nrc1      GD------------------
4198|gene|nph       NRS-----------------
2561|gene|hwa       TKQDEQDATRP---------
15550|gene|hbo      SSSELDDEDET---------