HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0357COG1571arCOG01115Predicted DNA-binding protein containing a Zn-ribbon domainalso an OB fold

HOG Organism Gene ID Name Annotation
cHOG0357 nrc1 VNG2110 dzr also an OB fold
cHOG0357 hmu HMUK0845 Hmuk_0845 domain of unknown function DUF1743
cHOG0357 hma RRNAC2518 hypothetical protein
cHOG0357 hwa HQ3056A hypothetical protein
cHOG0357 hla HLAC0272 Hlac_272 domain of unknown function DUF1743
cHOG0357 hbo HBOR28320 Hbor_28320 predicted DNA-binding protein containing a Zn- ribbon domain
cHOG0357 hut HUTA1790 Huta_1790 domain of unknown function DUF1743
cHOG0357 hvo HVO_0339 HVO_0339 OB-fold nucleic acid binding domain protein
cHOG0357 nph NP1318A hypothetical protein
cHOG0357 hhi 2948 HAH_2948 hypothetical protein
cHOG0357 hhi 354 HAH_0354 Dual specificity protein phosphatase
cHOG0357 hhi 4283 HAH_4283 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4283|hp|hhi        ---------------------------------------------MDRRLV---------
354|gene|hhi       ----------------------MGFVSD------APVIRQIGD----RSLYLGNKHAARP
3056|hp|hwa        ---------MTVIGIDDTDSRNRGMCTTYLATRIATAIEHAGG-TVERRLLIRLNPAVEH
272|gene|hla       ---------MPIVAVDDTDSRERGMCTTYVGARLAERLDAAGG-RVRRRLLVRLNPAVKH
2110|chp|nrc1      ---------MTVVALDDTDSRTAGMCTTYAAHLVAEELRAAGC-TVHRVLLVRLNPAVAY
1318|hp|nph        ---------MTVIGIDDTDSRERGMCTTYVADTIARALADAGH-EVRRVLLVRCNPAVEH
12518|hp|hma       ------------------------MCTTYAAATLAESIRNAGG-TVERLLLVRLNPAVEH
2948|hp|hhi        MTVSGLQALVTVVGLDDTDSRERGMCTTYAAASLAESIRDAGG-TVERLLLVRLNPAVEH
28320|hp|hbo       ---------MTVVGLDDTDSRERGMCTTYLATLVAEAIEAAGG-QVERRLLVRLNPAVEY
1790|hp|hut        ---------MTVIGIDDTDSRTAGMCTTYLAARIADRLAATDDWVVDRRLLVRLNPAVEY
                                                                  * *          

4283|hp|hhi        ------------------------------------------------------------
354|gene|hhi       ETHDQSFDYVLSA-----------------------------------------------
3056|hp|hwa        KTRGNAAIALHTD-IDPTDAVEISTQFIDSLAISDDPNTSPGVVITD---TCTPHS----
272|gene|hla       KTRGNAAVALHVSGVEAEAAFDLAAETVREFAAADDPRTSPGVVVADIDVAGDPSDPSAS
2110|chp|nrc1      KTRGNAALAVHAD-VDPQVGFDTARRVVDAHAETDDDRTNPGVVVAH------DAD----
1318|hp|nph        KTRGNAALAVHSD-APVEAASETARDIVESAAETADDRTNPGVVVAE----GPPEA----
12518|hp|hma       KTRGNAALAVHTD-LDADTALGLAEDVLD-MAETDDPRTNPGAIVAD----CDPED----
2948|hp|hhi        KTRGNAALAVHTD-LDADTALELAGDVLD-MAETDDPRTNPGAIVAD----CDPED----
28320|hp|hbo       KTRGNAALALHTN-LSPEEVLAIAVEELEPLAETSDPRTSPGVVVAP----GDPDA----
1790|hp|hut        KTRGNAALAIHTD-APVDAVREIVSEELP-IAETDDPRTNPGVVLAS----ESAAE----
                                                                               

4283|hp|hhi        ------------------------------------------------------------
354|gene|hhi       -------------------------------TSEAYPLTTAHHPLTDGPGN---------
3056|hp|hwa        -------------VADSVIDFCWDAIREFHTIADTVDLIEQVGYHHQGWDG---------
272|gene|hla       APPFPPSAASTAPIPADVADFARRALRHRLSLDEALTLADDHGFRHAAFGSGGETNTEAV
2110|chp|nrc1      -------------APAPVAAFAHRALRADIDPADAAALAAAHGYRTAGWGT---------
1318|hp|nph        -------------VPASVQSFSRTAIRGHHERHDAHAVIDSVGYQAHGWKN---------
12518|hp|hma       -------------VPPQVATFARETIRSIQDPMAATTLADVVGFARCQRGN---------
2948|hp|hhi        -------------VPPQVATFACETIQSIQDPMAATTLADVVGFARCQRGN---------
28320|hp|hbo       -------------VPDAVSSFTTRAIRSLVDTDDAVELADSADYFHRGWDG---------
1790|hp|hut        -------------IPEAVGDFARDAVRDFHDVADARALIDRLEYDTLEAGN---------
                                                                               

4283|hp|hhi        ----------------------------------------------------FEQIW---
354|gene|hhi       -------------EWAAF------------------EAAVDTARRF--------------
3056|hp|hwa        -GRGRIGALAAVGAWAALTEWTIEHIAYRQFNRCGTDRDVDEKSVFEAAKRQYPAVWDTV
272|gene|hla       AGRGRIGALAAVGAPAAFDDWTVERISYRELDRCGTPRDVDIESVFAAADRGYPTVWDTV
2110|chp|nrc1      -GRGVVGALAAVGAWTAFSDWTYECIQYRPRDRWGTTRRVDADSVFAAADDAYPAAWDTV
1318|hp|nph        -GRGVIGALAAVGAWKTLDDWTYEHIVYREPSRWGSDRDVSVESVFDAADSYYPEVWDTV
12518|hp|hma       -GRGLVGALAAVGAWAALSDWTYEHIAYRERDRWGTERAVDSESVRAAAEEYYPEVWDTV
2948|hp|hhi        -GRGLVGALAAVGAWAALSDWTYEHIAYRERDRWGTERAVDGESVRDVAAEYYPDVWDTV
28320|hp|hbo       -GRGRIGALAAVGAWAALEEWTYEHIAYREFDRCGTLRDVDIESVFDAAADHYPEAWDTV
1790|hp|hut        -GRGLIGALAALGAWRAFEDWTYEYISYREPPRRGTPREVGPESVFRAADAGYPDAWDTV
                                                                               

4283|hp|hhi        ----------------------------------------VTKRALLIETQ---------
354|gene|hhi       --------------------VRADGPALIHCKAG------VSRSSTLLA-----------
3056|hp|hwa        DREEDDAVCVPNAPGPILYGIRGDDVAAVKTVAAEIDSEPVERSSTFITNQGTDIHLRPG
272|gene|hla       DRGTGEAVCVPNAPGPILHGIRGDDANACREIAEEIASEPVERTATFLTNQGTDAHLAPG
2110|chp|nrc1      DHVEDDLVCVPHTPGPILYGIRGDDADAVQAVAADIDSEPPHARELFVTNQGTDAHLADA
1318|hp|nph        DRGTGEAVCVPKTPGPVLYGIRGDDPEACRAVAANIDSEPADSERTFVTNQGTDGHLQDG
12518|hp|hma       DRASGYPVCVPRTPCPILYGIRGDDPTACRAVADAIDSEPIARRATFVTNQGTDVHLQDA
2948|hp|hhi        DRASGYPVCVPRTPCPILYGIRGDDPDACRAVADAIDSEPIARRATFVTNQGTDVHLQDA
28320|hp|hbo       DTVEGQAVCVPNAPGPILHGIRGDDPDAVRSLSAAIDSEPVERRATFLTNQGTDIHLRDG
1790|hp|hut        DHVEDELVCVPHAPGPILHGIRGDDPDVVRGVAADIESEPIERTALFVTNQGTDAHLRQG
                                                                 ::            

4283|hp|hhi        ----------------PLVNPAKRPTAIILL-----------------------------
354|gene|hhi       ---------------TAIAAEEDRP-----------------------------------
3056|hp|hwa        TIGSLRDNRAYRVTGTVITDPETRPGGHVFVTLGKRETTEEDHIEETSSKESAVLTDTHH
272|gene|hla       AIGDLRDGAGYRVAGVVASEPETKRGGHVHVDVAA-------------------------
2110|chp|nrc1      PLADARDGRGYRVEGVVADHPETREGGHVFVPIT--------------------------
1318|hp|nph        AVGAARDGYAYRLSGTVAEAPETRRGGHVFFELV--------------------------
12518|hp|hma       TLDAVTADSAYRVTGTVVEASETRAGGHVFLTLE--------------------------
2948|hp|hhi        AVDAVTADSAYRVTGDVVDAPETREGGHVFVTLE--------------------------
28320|hp|hbo       TLGSLEADGAYRVDGVVVAAPETRRGGHVFFELGSAD-----------------------
1790|hp|hut        TIGTLRDGRAYRVTGVVDASPETREGGHVFLTIE--------------------------
                                          .                                    

4283|hp|hhi        ---------------------------------VINQRVDALLTTS--------------
354|gene|hhi       --------------------------------------LSNALAAVQEA-----------
3056|hp|hwa        LRTKSSNPDITDQNVSSTITCVAFEPTKRFRQWVRKLRVGDIITVCGEV-----------
272|gene|hla       ----------PDDDRVPRLRCVAFKPTGRFRDRVRALRPGDRVTVCGEHEVRLIGDSGGA
2110|chp|nrc1      -------------DGEATLACVAFEPTKRFRDHVRNLRPGDRITACGEV-----------
1318|hp|nph        ----------GDGDGTATLQCAAFEPTKRFRDRVRKLRVGDRITACGEC-----------
12518|hp|hma       -------------GDGATLDCAAFEPTKGFRNRVRSLKAGDRITACGEV-----------
2948|hp|hhi        -------------GDDTTLDCAAFEPTKGFRDRVRSLRVGDRITACGEV-----------
28320|hp|hbo       --KRGDADNGVDGDPDESIACAAFEPTKRFRDRVRTLRCGDELTVCGEF-----------
1790|hp|hut        ------------GDDGHALPCAAFEPTKRFRDRVRSLRVGDRVTVCGEV-----------
                                                          .  ::.               

4283|hp|hhi        ------------LSGISRLGNYRFS-----------------------------------
354|gene|hhi       -------------------------------------------------------RPIAT
3056|hp|hwa        ------------SNGTLKLEKFAIRSLTRTTKTAPICPGCNRTMKSAGRNQGYRCRDCGT
272|gene|hla       EDDGNDGPDSGQSTATLKLEKFAVRDLVETEPAVPTCPDCGRSMSSAGRGQGYRCRDCGT
2110|chp|nrc1      ------------ADGTLKLEKFAVRGLTRTTPTTPVCPDCGTTMESAGATQGYRCRDCST
1318|hp|nph        ------------TDGTLKLEKFAVRGLVRTERVTPVCPDCERTMESAGAGQGYRCRDCGT
12518|hp|hma       ------------TDGTLKLEKFAVRDLVRTEAVTPDCPDCGRSMKSAGRNQGYRCRDCGT
2948|hp|hhi        ------------TDGTLKLEKFAVRELVRTEPVTPDCPDCGRSMKSAGRNQGYRCRDCGT
28320|hp|hbo       ------------SDGTLKLEKFAVRELNRTELVTPTCPDCDRTMESAGRNQGYRCRDCRT
1790|hp|hut        ------------SDGTLKLEKFAVRDLVRTERVTPTCPACGRTMESAGRGQGYRCRDCST
                                                                               

4283|hp|hhi        ----------------------------------------------
354|gene|hhi       P-------------NPALYELAVI--YLAADP--------------
3056|hp|hwa        SSSTQSEKSLDRVLSLKWYEVPPCARRHIAQPLIRGDFDAPIMPER
272|gene|hla       DAPGKVEESIDRELEPGWYEVPPSARRHVAKPLVRGGFDGPIHPER
2110|chp|nrc1      TAPGTAHRLIERALDPGWYEVPPCARRHIAQPLVRGDWDAAVHPER
1318|hp|nph        AAEGKAEQPLSRDLEIGWYEVPPRARRHIAKPLVRGGFDAPVHPES
12518|hp|hma       SADGKTAQSIERGLERGWYEVPPVARRHIAKPLVRGGFDAPTHPSR
2948|hp|hhi        SADGKVEQSIERGLERGWYEVPPVARRHIAKPLVRGGFDAPTHPSR
28320|hp|hbo       SAPGKTESVIDRDLERGWYEVPPCARRHVAKPLVRGGFDAPVHPER
1790|hp|hut        AVDGKAEREIDRDLEVGWYEVPPCARRHIAKPLVRGGFDAPVHPER