HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0356arCOG00428hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0356 nrc1 VNG0789 vng789 no entry
nucHOG0356 hmu HMUK2133 Hmuk_2133 putative exonuclease RecJ
nucHOG0356 hma RRNAC1427 recJ2 putative exonuclease Recj
nucHOG0356 hwa HQ2360A rps operon protein
nucHOG0356 hla HLAC0616 Hlac_616 putative exonuclease RecJ
nucHOG0356 hbo HBOR20940 Hbor_20940 hypothetical protein
nucHOG0356 hut HUTA0724 Huta_0724 putative exonuclease RecJ
nucHOG0356 hvo HVO_1147 HVO_1147 conserved hypothetical protein
nucHOG0356 nph NP3206A rps operon protein
nucHOG0356 hhi 2011 recJ3 RecJ-like exonuclease
MUSCLE (3.6) multiple sequence alignment


789|chp|nrc1        -MATTGRSSND--SDGVRDVAGVVSGAEFVRVTAAPTGGCVVAAGLLAGVCDEVGVPSQV
2360|gene|hwa       -MTISTRSEMPTIDGSAESVATTLTDTAFVRVICRSNGDAIAAAGLLARALRRESTPFQI
20940|hp|hbo        MSAQIDPTQAP--DAPAESVASALADAAFVRVVCRADGDALAAGGLLARALRRTSVPFHV
3206|gene|nph       -MSAAGH-PEP--A--RDRVAATLRDAEFVRLVATADGDALAAAGLLASGLDAAEVPYQV
724|chp|hut         -MSTTGRQSGE--G--ARDAASRLREAGLVHLAPVATGDAIAATGVLARALDAIGVPFQI
616|gene|hla        MTEATSATPAP------DALADVLADAPFARLVATDDGDAVAAAGLLARALRAVGTPFQV
11427|gene|hma      -MSATGREPTP--ATSPGDLAGSLREAAFVRLVSDATGEALAATGLLARALD--DTPFQA
2011|gene|hhi       -MSATGREPTP--ATSPGDLAGSLREAAFVRLVSDATGEALAATGLLARALG--DTPFQA
                                        *  :  : :..:     * .:.* *:**       .* : 

789|chp|nrc1        ---RVVSEPPSHSGAADGSQAATPTASHVTVGCEAVAADASVTGVADAFALAREVGTHPD
2360|gene|hwa       RADQFGHANPTVTDQ--DDGCCIALGLSH-PAADININPVERSVTRSVYAVTEALTTPTH
20940|hp|hbo        RAGSFVSMPDAPD----DDGVLLAVGTDV-SDADATVAPDDGATSRRAYEVAAALTPAGE
3206|gene|nph       ---SLAAVPDPPAT---DADCTVAVGTDG---GDVTVS-ESPLAV-AAAEIVRSLAAEAV
724|chp|hut         ---SVVQTP-ADAARATEADRTVTLGPAS-QDADLTLGSDRPASV-AAFGVARSLDAPTT
616|gene|hla        ---RVSRDPVPDAG---DDAVAVTIGADRGPHAIPGLG--RPAST-DAFAIARALGVDPD
11427|gene|hma      ---SVVR-PFEDPDRTTETDITIAIGRTQ-LTADVTLT--DRAAA-TAFETARELGT-AD
2011|gene|hhi       ---SVVR-PFEDPDRTTESDITVAIGRTQ-PTADVTLT--DRAAA-TAFETARELGT-AD
                        .                  . .                     .   .  :     

789|chp|nrc1        ---------------------P-----VVTAAGAVADG-------------------VEP
2360|gene|hwa       ASESGVDTTDDVSGEDVNITIPPTDT-LLALAGIITTGVSLETKSASNNQEQTQAQSQTT
20940|hp|hbo        ---------------------PGPDP-VLALAGIVAAG-------------------EHP
3206|gene|nph       ---------------------DA----TLALAGAYCAG-------------------YEP
724|chp|hut         ---------------------DATDVVALAAAGVVAAG-------------------DEP
616|gene|hla        ---------------------P-----VVALAGVVAAG-------------------SVP
11427|gene|hma      ---------------------P-----ALALAGTIAAG-------------------DVD
2011|gene|hhi       ---------------------P-----ALALAGTIAAG-------------------DVD
                                                :: **    *                      

789|chp|nrc1        --------PADVRAAAE--AWTRRPGVGVPTADLAAGLAHSTLVHASFSGDEQAAGAFLA
2360|gene|hwa       DGSGFATSLLETLTTTDTVSVDQQPGVGIPISNVVDGLAHSTLMHASFSGDVDATHAMMA
20940|hp|hbo        GATDGG--LLSVAEETG--AVERRPGIAAPVADLADGLAHTTLAHASFSGDREAVTAVLA
3206|gene|nph       EGW--------LLEQAG---LERAPGIAIPTDDSIEGLAGSTLLHAGFSGDGEAAAAAVA
724|chp|hut         TGA-----LADALEEAD---IERRPGVAVPTADLADGLAYSTLVHAPFSGDPEAARATLA
616|gene|hla        -GTDGSGDALEAAEHTD--RVRRRPGVALPTVDLADGLAASMLVRTSYSGDSEAARAALA
11427|gene|hma      -GT-----VAEAAEQAG---LDQRPGVAVPGTDLADGLAHSTLFVAPFSGDADEARATLA
2011|gene|hhi       -GT-----VAEAAEQAG---LDRRPGVAVPGTDLADGLAHSTLFVAPFSGDADAARATLA
                                   :      . **:. *  :   *** : *  : :*** : . * :*

789|chp|nrc1        ELG-LP----------------PE------PDAAARRRLASAVALDA--TADAPPCAADA
2360|gene|hwa       EID-LDVDIDAHSSEGDDQGEFTDAVSLINLSDEDQRTIASAVTIDVIKASTPTVGTAIS
20940|hp|hbo        DLD-LP----------------AE------PDDAAHRTLASLVALDVAGDDDATVRAAES
3206|gene|nph       DLE-----------------------------TADGRSLASLAALSA--VEDAPPRAANA
724|chp|hut         ERDALD----------------PK-------DDEARLRAASIVALTAVEGADADSRASEA
616|gene|hla        DLG-LP----------------AD------LDDDAHRRLASLVAVDVADAEGASTRAASA
11427|gene|hma      ELD-IS----------------PD----GPPSADDHRRLASLVALTV--TTDAPPRAADA
2011|gene|hhi       DLG-LD----------------ADRIQSADFSADDHRRLASLVALAV--TADAPPRAANA
                    :                                      ** .:: .     .   :: :

789|chp|nrc1        VHDALRPRATPD--GMMATVEGYADVLNAVAWAAPGHGVALGLGVAD----RTAVLAAWQ
2360|gene|hwa       LEQALHPQYLPD--GPMTTIEGYADVLRAVSRERPGTAIAFAISHDA----SDAALSAWR
20940|hp|hbo        VERAFKPYATPD--APFTTLGGYADVLDAVARERPGTGVALALGHET----RVPALEAWR
3206|gene|nph       VQRFLHPHSV----DRFETLGGFADVLDAVAREHPGSGIALALGHDI----EETALEAWR
724|chp|hut         VEDVLRP--YAG--GPLTTIGGYADVLDAAAREQPGVAVALALGHEP---AIEGALSAWR
616|gene|hla        VERALRPYATVGDAAPFETVGGYADVLDALAREAPGTGVALALDSDPGDELRAAALDAWR
11427|gene|hma      VQRALRP--TAG--GPFETVGGYADVLDAVAREQPGTAVALALGHEA---VSEDALAAWR
2011|gene|hhi       VQRALRP--TVG--GPFETVGGYADVLDAVAREQPGTAVALALGHEA---VREDALAAWR
                    :   :.*         : *: *:**** * :.  ** .:*:.:.          .* **.

789|chp|nrc1        AHAAPSHAAVRAASLARHRGVVVADV-----------PTASPT-----------------
2360|gene|hwa       EHAQAVHHILQTAHTGRYDGVYLLRCR-DHDEFQDSSTTSGPDETSNTTESGRTETDSSV
20940|hp|hbo        DHAAAAHRTLSEGHTGRYEGVHVVRA-----------TDAVAT-----------------
3206|gene|nph       SHGQRAHEAVRSASSSRYDGVSVVRV-----------DGAAPD-----------------
724|chp|hut         THAERAHDAVRDATVRRHAGLVVAE-------------TAGPT-----------------
616|gene|hla        SHGLAAHRALDDATIGRYDGCLVARVALAGGDRSEEDGDAAPD-----------------
11427|gene|hma      SHATRAHDAVSEATTGRYDGLFVAR------------GDAMPT-----------------
2011|gene|hhi       SHATRAHEAVSAATTGRYDGLFVAR------------GDAMPT-----------------
                     *.   *  :  .   *: *  :                : .                  

789|chp|nrc1        -----------VARLLRDYRATEPAVLAVGTETAALATTD--------------------
2360|gene|hwa       GDISTPGRLLTVAELASRYQTPESLVLAIGEEVVAVATQPTRDTQST-STTVDAVVVAEA
20940|hp|hbo        ----HPGRLATVARLARDFRSPEPMALVIGDGVAALAAVEHGAARAA-----------SA
3206|gene|nph       ----T---LGTVARLWFHYRSPEPTVVAVTD--GAAAVTAEGAVESP-------------
724|chp|hut         ----G-----TVARLVRDFRSPEPLALVADGDRATLAAIADHDARAI-------LDSATA
616|gene|hla        ----AAAVLPTVARLVRDFRSPEPVAVAVDEAAGRLAAAATGGGRAAGGATAEPIGLGDA
11427|gene|hma      ----G-----TVARLFADYRAPEPVTLVVTDDRAAARATDGRDVAET-------------
2011|gene|hhi       ----G-----TVASLFADYRAPEPVTLVVTDTEAAARATDGRDVAET-------------
                               ** *   :.:.*. .:.         .                      

789|chp|nrc1        --------------------------------ADAHAVLPGSVGTRRRAVT---------
2360|gene|hwa       LRTNIDIETTDIPAENNAVSQMDSTTTPAESDDVDDGANAGDTGNDEINQMQDGWVGDAN
20940|hp|hbo        VA------------------------------DEFGGVDAGAWSGDARRAVV--------
3206|gene|nph       LR------------------------------EATTALGGRSTARNGHG-----------
724|chp|hut         SI------------------------------DHAEAVAGDA----DRA-----------
616|gene|hla        CR------------------------------SAASEVGGDGWGTADRGGIAVGTADEAD
11427|gene|hma      MH------------------------------AAAETVGGDAVGTGDRA-----------
2011|gene|hhi       MH------------------------------AAAETVGGDAVGTGDRA-----------
                                                                                

789|chp|nrc1        ----TLGDSSDADAVIETVRGGL----
2360|gene|hwa       QALVRVNSTVPPAEIIAVVRELTREES
20940|hp|hbo        ----RFDADTPEAEIIAAVREAST---
3206|gene|nph       ----TATFDASATDFTAAIREAL----
724|chp|hut         ----HLTVSGATETLVAAVREVIADE-
616|gene|hla        RIEEREATDGDITGALAALREAL----
11427|gene|hma      ----RARFDVSTADFIEAFREAV----
2011|gene|hhi       ----RARFDVSTADFIEAFREAV----
                                     ..*