HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0354COG0142KOG0776 KOG0711arCOG01726Geranylgeranyl pyrophosphate synthaseputative isopentenyl pyrophosphate isomerase

HOG Organism Gene ID Name Annotation
cHOG0354 nrc1 VNG2153 fps putative isopentenyl pyrophosphate isomerase
cHOG0354 hmu HMUK1268 Hmuk_1268 Polyprenyl synthetase( EC:2.5.1.10 )
cHOG0354 hma RRNAC3146 fps farnesyl-pyrrophosphate synthase
cHOG0354 hwa HQ3255A idsA multifunctional long-chain (E)-prenyl diphosphate synthase
cHOG0354 hla HLAC0241 Hlac_241 Polyprenyl synthetase
cHOG0354 hbo HBOR28690 Hbor_28690 farnesyl-diphosphate synthase( EC:2.5.1.10 )
cHOG0354 hut HUTA1426 Huta_1426 Polyprenyl synthetase
cHOG0354 hvo HVO_0303 HVO_0303 fps farnesyl-pyrrophosphate synthase
cHOG0354 nph NP0604A idsA_2 multifunctional long-chain (E)-prenyl diphosphate synthase
cHOG0354 hhi 412 fps farnesyl-pyrrophosphate synthase
MUSCLE (3.6) multiple sequence alignment


2153|gene|nrc1      MEYVEARRAAIEQRITEAVGGVEPTELGDQLEHVVLAGGKRVRPTLTVLVCEAAGGAVWT
3255|gene|hwa       ---------MVEDRLESVVDAIDPAVLSDEVAHVALSGGKRVRPAVTILACEACGGA---
241|gene|hla        MEYLERRVALAEDRLEAVIDEVEPDELSEEVGHVVLAGGKRVRPAVTILACEAFDGD---
28690|gene|hbo      MEYLERRVSMVDDRLEAVIDAVDPPELSDELAHVALAGGKRVRPAVTILSCEACGGD---
604|gene|nph        MEYLERRRALVESRLEAVLDATEPDAMTDRLEHVSLSGGKRVRPMVALLAFEAAGGEL--
1426|gene|hut       MEYLERRRDLIETRLEDVLASVDPAELSSELENVVLAGGKRVRPTVSLLVCEAVGAE---
13146|gene|hma      MEYLERRRDRVEERLEAVLDSVEPEELADEVRHVALSGGKRVRPTVTVLVCEALGGE---
412|gene|hhi        MEYLERRRDRVEERLEAVLDSVEPDELADEVRHVALSGGKRVRPTVTVLVCEALGGE---
                               : *:  .:   :*  : . : :* *:******* :::*  ** ..    

2153|gene|nrc1      GAAEAAAVRENAALSAGGEDALDYAVGVELVHNASLVVDDIIDRSELRRGSASAWAEYGY
3255|gene|hwa       -----------------PEDAVDFAVAVELVHNASLVVDDIIDRSDVRRGTESAWSAFGH
241|gene|hla        -----------------PDAAVDFAAGIEFVHNASLVIDDIIDRSEVRRGTPSAWAEYGY
28690|gene|hbo      -----------------ADAAVDFAVAIELVHNASLVIDDIIDRSDIRRGTPSAWAEYGY
604|gene|nph        -------VGEDGRGSEPSRNAIDFAVGIELVHNASLVVDDIIDESELRRGVDSAWAAFGY
1426|gene|hut       -----------------PEDAVDFAVGVELVHNASLVVDDIIDESDRRRDSPSAWSAFGH
13146|gene|hma      -----------------PADAVDFAVGIELVHNASLVIDDIIDESELRRGSPAAWEAFGH
412|gene|hhi        -----------------PADAVDFAVGIELVHNASLVIDDIIDESELRRGSPAAWEAFGH
                                        *:*:*..:*:*******:***** *: **.  :**  :*:

2153|gene|nrc1      GPGIVASDGLLGEAFALFSRDPRAMECVTDSLVELGEGEAIELVARPETEREYMELARRK
3255|gene|hwa       GPALIASDGLLGEAFALLAADEHATEIVAESMVELGEGEATELVARPTNEAEYMQLARRK
241|gene|hla        GPAIIASDGLLGEAFALFSADPRAMRTVAEALVELGEGEATELAARPTTEAEYMELARRK
28690|gene|hbo      GPSIIASDGLLGEAFALLSVDDHAMQIVAESMVELGEGEATELVARPTNEAEYMELARRK
604|gene|nph        GPAITTSDGLLGEAFSLFSADPRAMRTVAEAMVELGEGEATELVERPDSEAAYMELARRK
1426|gene|hut       GPALIASDGLIGEAFALFSTDERAMRAVSEAMVELGEGEATELAAMPDSEDAYRQLARRK
13146|gene|hma      GPAIIASDGLLGEAFNLFSTDERAMQTVSESMVELGEGEAMELVAEPSNEKEYMELARRK
412|gene|hhi        GPAIIASDGLLGEAFNLFSTDERAMQTVSESMVELGEGEAMELVAEPSNEKEYMELARRK
                    **.: :****:**** *:: * .*   *::::******** **.  * .*  * :*****

2153|gene|nrc1      TGALFRAAAELGAIAADADGRAVERFGEYAERVGVAFQIRDDVLDATADSDALGKPAGVD
3255|gene|hwa       TGALFRASAEVGAVAGGADPFTIDLFGEYAERVGVAFQIRDDVLDATADATDLGKPTGQD
241|gene|hla        TGALFRAAAELGAIAGGADSHAVDSFGEYAERVGVAFQMRDDVLDATADADDLGKPTGQD
28690|gene|hbo      TGALFRAAAELGAVAADADPFTVEAFGEYAERVGVAFQIRDDVLDATADADELGKPTGQD
604|gene|nph        TGALFRAAAELGAIAADADTYAVDAFGQYAERVGIAFQIRDDVLDATADADDLGKPTGQD
1426|gene|hut       TGALFRAAAELGAIAADADARTVEAFGQYAEQVGIAFQIRDDVLDATGDAEQLGKPAGHD
13146|gene|hma      TGALFRAAAELGAIAADSDPYTVEAVGQYAERVGVAFQMRDDVLDATADAETLGKPAGTD
412|gene|hhi        TGALFRAAAELGAIAADSDPYTVEAVGQYAERVGVAFQMRDDVLDATADAETLGKPAGTD
                    *******:**:**:*..:*  ::: .*:***.**:***:********.*:  ****:* *

2153|gene|nrc1      EALDRPSIVQVTDRSPDALNRLAGEQSERALGALAELELPDGEAKDYLQYLAEFVVERDA
3255|gene|hwa       AAMDRPSLIQVTALSDTEANERAHNESQQALDALAAANIDDTESLGYLRDLAEFVVIRER
241|gene|hla        AEMDRPSVLQVTSLSPEEIDERAREQSELALAALDDADPPETEAIEYLRDLAEFVVVRER
28690|gene|hbo      EQMDRPSVVQVTDLTPVEANQRAREQSDKALDALDTAKLSETDSLGYLRDLAEFVVVRER
604|gene|nph        AEMERPSVVQITDMSPDEANERARTESDAALSSLSAADTVDSEAVGYLEDLAEFVVVRER
1426|gene|hut       AEMDRPSIVQVTDLSPAEATERARSEADAALDQLETVPVENEQAVEYLRDLANFVVERER
13146|gene|hma      AEMERPSLVEVTELTTEEANERARAESDAALESLSTIDAPESQSMEYLRDLAEFVVVRER
412|gene|hhi        AEMERPSLVEVTELTTEEANERARAESDAALESLSTIDAPESQSMEYLRDLAEFVVVRER
                      ::***::::*  :       *  ::: **  *      : ::  **  **:*** *: