HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0353COG1547arCOG04628Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0353 nrc1 VNG1402 vng1402 no entry
cHOG0353 hmu HMUK2225 Hmuk_2225 protein of unknown function DUF309
cHOG0353 hma RRNAC1037 lbp leucine-binding protein
cHOG0353 hwa HQ3006A hypothetical protein
cHOG0353 hla HLAC2598 Hlac_2598 protein of unknown function DUF309
cHOG0353 hbo HBOR13640 Hbor_13640 uncharacterized conserved protein
cHOG0353 hut HUTA2840 Huta_2840 protein of unknown function DUF309
cHOG0353 hvo HVO_2853 HVO_2853 Domain of unknown function (DUF309) family
cHOG0353 nph NP2662A hypothetical protein
cHOG0353 hhi 1651 HAH_1651 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10370|gene|hma      MDSGRNGGGPSVFRRDLLRSIGAAGLAGLAGCGGSEGVTDGDGTPAPTPV-GNFPVSGDS
1651|hp|hhi         MDDH----------------------------------TRDPTVEA--PD-G-NPS----
2840|hp|hut         MDEH----------------------------------TRDDSVGP--PA-G-SPT----
2662|hp|nph         MDDH----------------------------------TVDNDVPP--PTNG-DPT----
3006|hp|hwa         MTEH----------------------------------TRDDSISP--PI-GTNPT----
1402|hp|nrc1        MDDH----------------------------------TRAPGVAP--PL-G-DPT----
2598|gene|hla       MDEH----------------------------------TRDPGVAP--PL-G-NPT----
13640|hp|hbo        MDDH----------------------------------TRDPGVAP--PL-G-EPT----
                    * .                                   *      .  *  *  *     

10370|gene|hma      VTFGFNVASSGAYSTAGKQEIRGFKLAVKHINNGGGWVTSEKYNSPLDGDGLLGKDVEFV
1651|hp|hhi         -----------------------------------GWR----------------------
2840|hp|hut         -----------------------------------GWD----------------------
2662|hp|nph         -----------------------------------GW-----------------------
3006|hp|hwa         -----------------------------------GW-----------------------
1402|hp|nrc1        -----------------------------------GWL----------------------
2598|gene|hla       -----------------------------------GWHAAGEGGADEGGAGDGGADGGDP
13640|hp|hbo        -----------------------------------GWL----------------------
                                                       **                       

10370|gene|hma      VEDTGGSSDTARSNAQRLVDGEEVIMLAGGTSSSAGLANQEVAAQNQVIYMATMANTNSL
1651|hp|hhi         -TDGQ-----WEHETLRRAVVHGVRLYNSGEFHES-------------------------
2840|hp|hut         -PDAE----QWEHATLRRAVVHGVALYNDGAFHES-------------------------
2662|hp|nph         -QRRRGRSNGWEHGTLRRAVVHGVRLYNDGAYHES-------------------------
3006|hp|hwa         -TDSGLTSNGWEHGTLRRAVIHGVRLYNSGEFHES-------------------------
1402|hp|nrc1        -TDRR----VWEHATLRRAVEHGVRLFNSGDYHEA-------------------------
2598|gene|hla       DADARLAGGHWEHATLRRATEHGVRLFNAGAYHES-------------------------
13640|hp|hbo        -ADRR----EWEHATLRRATEHGIRLYNAGEFHES-------------------------
                                  : * .    : :   *   .:                         

10370|gene|hma      TGADCNRYSFREMFNNHMAAEALAPALSDEFGKNANYVKIFQDNDWGQTLRDDMDAALGN
1651|hp|hhi         --HDC-----------------------------------FED-EWYNYGRGNTESKF--
2840|hp|hut         --HDC-----------------------------------FED-EWYNYGRGTTESAF--
2662|hp|nph         --HDC-----------------------------------FEA-EWYNYGRGTAESAF--
3006|hp|hwa         --HDC-----------------------------------FEA-EWYNYGRGTAESAF--
1402|hp|nrc1        --HDC-----------------------------------FEV-EWYNYGSGTDESAF--
2598|gene|hla       --HDC-----------------------------------FED-EWYNYGSGTAESAF--
13640|hp|hbo        --HDC-----------------------------------FEV-EWYNYGRGTIESAF--
                       **                                   *:  :* :   .  :: :  

10370|gene|hma      VGWAPVWDTTAQVGTSDYSQYAADIKSVDFDVIVLGLGGLDAVNALRAFRDEFPESNIVL
1651|hp|hhi         ------LHGMVQVAAGAY-------KHFDFED----------------------------
2840|hp|hut         ------LHGMVQVAAGAY-------KHDDFEN----------------------------
2662|hp|nph         ------LHGMVQVAAGAY-------KHFDFED----------------------------
3006|hp|hwa         ------LHGMVQVAAGAY-------KHFDFTN----------------------------
1402|hp|nrc1        ------LHGMVQVAAGAY-------KHVDFEN----------------------------
2598|gene|hla       ------LHGMVQVAAGAY-------KRVDFEN----------------------------
13640|hp|hbo        ------LHGMVQVAAGAY-------KHFDFEN----------------------------
                              .**.:. *       *  **                              

10370|gene|hma      PMASREIAETAGGAIEGVIGTVAWSRAINSPLSNTFRETFREEYGSSTGSSKSAAPSGAA
1651|hp|hhi         --------------------------------DDGMRSLFRT------------------
2840|hp|hut         --------------------------------DDGMRSLFET------------------
2662|hp|nph         --------------------------------DDGMRSLFET------------------
3006|hp|hwa         --------------------------------DDGMRSLFHT------------------
1402|hp|nrc1        --------------------------------DDGMRSLFRT------------------
2598|gene|hla       --------------------------------DDGMRSLFET------------------
13640|hp|hbo        --------------------------------DDGMRSLFTT------------------
                                                    .: :*. *                    

10370|gene|hma      HIAYTQALQYASAVERAGTFNPIDVIGALEGHEYDAGLGPQTLRACDHQAMRQVPVVRG-
1651|hp|hhi         ------SLQYFRGV-------PNDY--------Y--GVDLLDVRTTVTNALSDPSALQGW
2840|hp|hut         ------ALQYLQDV-------PRDY--------Y--GVAILDVRTTVTNAIADPTVLDGW
2662|hp|nph         ------ALQYLEGM-------PRDY--------Y--GVDVLAVRTAVTNAINDPAELAGW
3006|hp|hwa         ------ALQYLKGV-------PTDF--------Y--GIDLDDVRQTLEDAIDDPTTLHGW
1402|hp|nrc1        ------AVQYLGDI-------PADY--------Y--GVDVGEIRRVIQAARADPSALSGW
2598|gene|hla       ------ALEYLRGI-------PGDF--------Y--GVDLDEVRATLRAALDDPTAIDGW
13640|hp|hbo        ------ALEYLRGT-------PADF--------Y--GVGVEEIRQTLRAALDDPTVLHGW
                          :::*           * *         *  *:    :*     *  : . : * 

10370|gene|hma      KSEIQQSYGTYYDLIGEPADVQYACDSGPAANCSLGGS
1651|hp|hhi         QIRLDGEYPTCR-----PEDIEFAESLE--H-------
2840|hp|hut         VITLDGEAPEAR-----DADYQYAESLE----------
2662|hp|nph         QIPLDGERPTAR-----PVDFEYARRLD----------
3006|hp|hwa         RIKLDDAHPEAS-----TRDMEYAEQLE----------
1402|hp|nrc1        GITLDDATPTAY-----PADYEYAEALE----------
2598|gene|hla       KITIDGARPEAY-----PADYEYAERLDEGH-------
13640|hp|hbo        QIELDDARPTAY-----PADYEYAEGLD--H-------
                       ::              * ::*