HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0352COG1243KOG2535arCOG01361Histone acetyltransferaseElp3-like histone acetyltransferase

HOG Organism Gene ID Name Annotation
cHOG0352 nrc1 VNG1510 act5 Elp3-like histone acetyltransferase
cHOG0352 hmu HMUK2192 Hmuk_2192 histone acetyltransferase, ELP3 family( EC:2.3.1.48 )
cHOG0352 hma RRNAC0974 hypothetical protein
cHOG0352 hwa HQ1798A hat histone acetyltransferase-like protein
cHOG0352 hla HLAC1480 Hlac_1480 histone acetyltransferase, ELP3 family
cHOG0352 hbo HBOR14000 Hbor_14000 histone acetyltransferase, ELP3 family( EC:2.3.1.48 )
cHOG0352 hut HUTA2930 Huta_2930 histone acetyltransferase, ELP3 family
cHOG0352 hvo HVO_2888 HVO_2888 hat histone acetyltransferase
cHOG0352 nph NP2872A protein acetyltransferase
cHOG0352 hhi 1602 HAH_1602 histone acetyltransferase, ELP3 family
MUSCLE (3.6) multiple sequence alignment


2930|gene|hut       -----------------------------MSTDAP---------------------EAVE
1510|chp|nrc1       -----------------------------MSSNAD------------------------D
1798|gene|hwa       -----------------------------MSTETDTED------------TGSEPDPTET
1480|gene|hla       -----------------------------MSTDAASDGDAGSEGGDAGGGSGSEATGDEP
10974|hp|hma        -----------------------------MSTETP--------------------DPDET
1602|gene|hhi       -----------------------------MSTETP--------------------DPDET
14000|gene|hbo      MSDTLNLETTRLKANENLRSNGRCGGDAAVSADTDPTE------------T---EDPTET
2872|gene|nph       -----------------------------MSADTD----------------------AES
                                                 :*:::                          

2930|gene|hut       DPFERACEELIERILEGDLDRDGLEAAKRDVCSKHSSPKVPKNSDLLDRAPDGRRDELAA
1510|chp|nrc1       GAFQAACEELVSRILAGDVGKDDIEDAKLDVCGEYAASKVPKHSDLLDVAPDGRRDELED
1798|gene|hwa       EAFRSTCKHLVEQIVAGDVDRDSLESAKLDACSQYGSPKVPKNTDILSHASAANRDDVKS
1480|gene|hla       EAFVRACEYLVDRILAGEIDRDDLESAKLDACSKFSSPKVPKNTEILDHAPTEARDDVIE
10974|hp|hma        ETFQQVCAELVDRILAGEVERDDVESAKIDVCREYSAPKVPKNSELLDYAPQEHREVLEE
1602|gene|hhi       ETFQQVCAELVDRILAGEVERDDVESAKIDVCREYSAPKVPKNSELLDYAPQEHREVLEE
14000|gene|hbo      EAFRRTCETLVERILDGEIEKDDLESAKLNACSKHSSPKVPKNADILQYAPDGRREEVKE
2872|gene|nph       EVFERVCESLVEGILDGDIDRDNLESAKMDACREHSSPKVPKNTDLLDYAPEEQREELES
                      *  .*  *:. *: *:: .*.:* ** :.* :..:.****::::*. *.   *: :  

2930|gene|hut       VVRRKPMRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFESSQSYTGQEPAAARGVQN
1510|chp|nrc1       VLQRKPVRTASGVTPVAIMTSPHTCPHGKCLYCPGGPASEFTSSQSYTGHEPAAARGVQN
1798|gene|hwa       VVRRKPVRTASGVSPIAIMTSPHMCPHGKCLYCPGGPASEFDSAQSYTGHEPAAARGKQN
1480|gene|hla       VVQRKPVRTASGVSPVAIMTSPKLCPHGKCLYCPGGPASEFSSAQSYTGHEPAAARGEQN
10974|hp|hma        VLQRKPVRTASGVSPIAIMTSPERCPHGKCLYCPGGPDSEFSSAQSYTGHEPAAARGEQN
1602|gene|hhi       VLQRKPVRTASGVSPIAIMTSPERCPHGKCLYCPGGPDSEFSSAQSYTGHEPAAARGEQN
14000|gene|hbo      VVQRKPVRTASGVSPVAIMTSPHMCPHGKCLYCPGGPASEFSSSQSYTGHEPAAARGVQN
2872|gene|nph       VLQRKPVRTASGVSPVAIMTSPHMCPHGKCLYCPGGPASEFSSSQSYTGHEPAAARGVQN
                    *:.***:******:*:******  ************* *** *:*****:******* **

2930|gene|hut       DYDPYGQVTLRLHQLRKIGHPIEKVELILMGGTMTARSHDYQEWFVKRALQAMNEYDPDC
1510|chp|nrc1       DYDPYGQVTLRLHQLRQIGHPVDKVELILMGGTMTARSHDYQEWFVKRALQALNDFDPDQ
1798|gene|hwa       EYDPYGQVTLRLEQLRHIGHPVDKVELIIMGGTMTSRSHDYQEWFLKRALEAMNDYDTDS
1480|gene|hla       DYDPYGQVTLRLEQLRKIGHPVDKVELILMGGTMTARSHDYQEWFVKRALQAMNDYDLDK
10974|hp|hma        DYDPYGQVTLRLNQLREIGHPVDKAELIVMGGTMTARSHDYQEWFVKRALEAMNDFDVDG
1602|gene|hhi       DYDPYGQVTLRLNQLREIGHPVDKAELIVMGGTMTARSHDYQEWFVKRALEAMNDFDVDS
14000|gene|hbo      DYDPYGQVTLRLEQLRHIGHPVDKVELILMGGTMTARSHDYQEWFVKRALEAMNDYDLDS
2872|gene|nph       DYDPYGQVTLRLHQLREIGHPVDKVELILMGGTMTARSHDYQEWFVKRALEAMNDYDLDS
                    :*********** *** ****::*.***:******:*********:****:*:*::* * 

2930|gene|hut       DPQPSETESFAQDPDAYDFRYLEDVIADNETGSIRNVATTFETKPDWCGPEQVDRMLRLG
1510|chp|nrc1       EPAPNQTESFAQDPAEYDFRYLEDVIADNEHGALRNIGTTFETKPDWCDPEQVDRMLDLG
1798|gene|hwa       KPDPASDQSFKPDPEDVEFRYLEDVIAENETADIRNIGTTFETKPDWCDPEQIDRMLDLG
1480|gene|hla       EPEPAEGESFAPAPEETEFEYLEDVIAENETNEIRNIGTTFETKPDWCDPEQIDRMLDLG
10974|hp|hma        EPTPAEDVSFAED--DYEFRYLEDVIAENETADVRNVATTFETKPDWCDPEQIDRMLDLG
1602|gene|hhi       EPTPAEDVSFAED--DYEFRYLEDVIAENETADVRNVATTFETKPDWCDPEQIDRMLDLG
14000|gene|hbo      DPQPAEDQSFKPDPEDVEFRYLEDVIAENETADVRNIGTTFETKPDWCDPEQINRMLDLG
2872|gene|nph       PPAPSEEDSFKPDPEDVDFRYLEDVIAENETANIRNIGTTFETKPDWCDPEQIDRMLRLG
                     * * .  **       :* *******:**   :**:.**********.***::*** **

2930|gene|hut       GTKVEVGVQTTYESINREMHRGHGVDASIEANRRLRDAGFKVGFHMMPGQPGMTEEMVRE
1510|chp|nrc1       ATKVEVGVQTTFERVNREMHRGHGVQASVDANRRLRDAAFKVGFHMMPGQPGMSKEMVLE
1798|gene|hwa       ATKVEVGVQTTYERINREMHRGHGVQASIDANQRLRDAGFKVGFHMMPGQPGMTSKMIRE
1480|gene|hla       GTKVEVGVQTTYERINREMHRGHGNEASRNANRHLRDAAFKVGFHMMPGQPGMTREMCVE
10974|hp|hma        ATKVEVGVQTTFERINREMHRGHGVQASIDANRRLRDSGFKVGFHMMPGQPGMSKEMCLE
1602|gene|hhi       GTKVEVGVQTTFERINREMHRGHGVQASIDANRRLRDSGFKVGFHMMPGQPGMSKEMCLE
14000|gene|hbo      ATKVEVGVQTTYERINREMHRGHGVQASLDANRRLRDSAFKVGFHMMPGQPGMTKEMCVE
2872|gene|nph       GTKVEVGVQTTYERINREMHRGHGVQASLDANRRLRDAGFKVGFHMMPGQPGMSKEMCLQ
                    .**********:* :********* :** :**..***:.**************: :*  :

2930|gene|hut       DFRRLFEQPEWRPDYLKIYPTLVVGGTVTYDMHRRDEFEPLTSEEAAELVADVKPMIPEY
1510|chp|nrc1       DFRRLFDDERWKPDYLKIYPTLVVRDTITYDMWRNGDFEPLHNEEAADLVAEIKDMIPRY
1798|gene|hwa       DFRQLFNRTEYRPDYLKIYPTLVVRGTRVYDQWRRDDFEPLDNETAAEIIAEVMGMIPEY
1480|gene|hla       DFRQIFENPDWRPDYLKIYPTLVVEGTRVYDRWRQDSFEPLSNEEAADVVADAMDQIPKY
10974|hp|hma        DFRRIFEQTDWRPDYLKIYPTLIVEGTVTYDWWRKDEFDPLDNDEAAELVAEIKDMIPRY
1602|gene|hhi       DFRRIFDQTDWRPDYLKIYPTLIVEGTVTYDWWRNDEFDPLSNDEAAELVAEIKDMIPRY
14000|gene|hbo      DFRQLFENSDWRPDYLKIYPTLVVRDTITYDMWRRDEYEPLNNEEAADVVAEVMGMIPKY
2872|gene|nph       DFREIFENADWRPDYLKIYPTLIVRDTVTYDMWRRDEYEPLNNEEAAELVAEIKSMIPRY
                    *** :*:   :.**********:* .* .** .*...::** .: **:::*:    ** *

2930|gene|hut       TRLQRVQRDIPAPLIEAGVQKSNLRQLARQRMESRGESCSCIRCREVGHSDEEPDE--VT
1510|chp|nrc1       TRLQRVQRDIPADFIDAGVWKSNLRQLARQRMAEHGYTCDCIRCREAGMNDDDPEN--VS
1798|gene|hwa       TRLQRVQRDIPADFIDAGVWKSNLRQLASQRADEKGIEIRDIRAREAGLNETDPDPEHIE
1480|gene|hla       TRLQRVQRDIPADFIEGGVWKSNLRQLADQRAEEKGIVQRDIRAREVGHNDADPDPDDVE
10974|hp|hma        TRLQRVQRDIPADFIEGGVWKSNLRQLAWKRMEEHDWTCDCIRCREAGHSDDVAEN--IE
1602|gene|hhi       TRLQRVQRDIPADFIEGGVWKSNLRQLAWQRMEEHDWTCDCIRCREAGHSDDAAEN--IE
14000|gene|hbo      TRLQRVQRDIPADFIDAGVWKSNLRQLAEQRAAEKGIELNDIRSREVGMNDADPDPERVE
2872|gene|nph       TRLQRVQRDIPADFIDAGVWKSNLRQLARKRMEAHGWECDCIRCREVGMNDEDPDT--VE
                    ************ :*:.**.******** :*   ..     **.**.* .:  .:   : 

2930|gene|hut       LDVEKYEVAGGTEHFISFEDRDRDLLVGFSRLRFP-------------GEVVRPELEEAA
1510|chp|nrc1       LDVETYAAGGGTEQFISIEDFQQDLLVGFARLRFP-------------NEPAREELTDAA
1798|gene|hwa       LNEMTYDVAGGTEHFLKFEDSYADLLIGFCRLRFP-------------GATVRRELKNAA
1480|gene|hla       LDVLTYEAGGGTEHFISFEDPVRDLLVGFCRLRFPSFAPDQPGAPGTEDDPIRRELEDAA
10974|hp|hma        LDVMTYEACGGMEHFISFEDFENDVLVGFCRLRFP-------------NDPVRRELQDAA
1602|gene|hhi       LDVMTYEACGGTEHFISFEDFDNDVLVGFCRLRFP-------------NDPVRRELQDAA
14000|gene|hbo      LQVETYEAAEGTEHFISFEDPAENLLIGFCRLRFP-------------HDPVRRELENAA
2872|gene|nph       LNVDTYEAAGGTEHFISIEDFEKDLLVGFCRLRFP-------------NDPVRAELEDAA
                    *:  .* .  * *:*:.:**   ::*:**.*****                 * ** :**

2930|gene|hut       VIRELHVYGSEIPIG------EAGEDGDDWQHQGYGKRLIERAEALAADAGYGKIAVLSG
1510|chp|nrc1       LLRELHVYGSEVSVG------DDTGDD-QHQHQGYGRQLMERAEHLAADSGFEKLSVISG
1798|gene|hwa       VVRELHVYGSEAGIGATANKSESTGDT-AWQHKGYGKRLITRAEELAREAGYDSLAIISG
1480|gene|hla       LIRELHVYGSEVAIG---------GAG-DWQHQGYGTKLLERAEELARDAGYRKLAIISG
10974|hp|hma        IVRELHVYGNAVGVG-------QEGDDEDHQHKGYGKKLLEKAEVLARDAGFPKLAVISG
1602|gene|hhi       IVRELHVYGNAVGVG-------QEGDDEDHQHKGYGKKLLEKAETLARDAGYPKLAVISG
14000|gene|hbo      LVRELHVYGSEVGLG---------GDG-DWQHKGYGRRLLEHAEEIARDAGYEKMSVISG
2872|gene|nph       IVRELHVYGSEVGVG------KQTDDG--HQHEGHGRRLLSTAEALAADAGYDKLSVISG
                    ::*******.   :*              .**:*:* .*:  ** :* ::*: .::::**

2930|gene|hut       IGAREYYRDQLGYCQDGPYVSKRLD-
1510|chp|nrc1       IGARQYYKQQLGYHQDGPYVSKRL--
1798|gene|hwa       IGARQYYRQKLGYHQDGPYVAKKL--
1480|gene|hla       IGAREYYRNKLGYHQDGPYVSKRL--
10974|hp|hma        IGVRQYYREKLGYKQDGPYVSKRL--
1602|gene|hhi       IGVRQYYREKLGYKQDGPYVSKRL--
14000|gene|hbo      IGVREYYKQKLGYHQDGPYVSKRF--
2872|gene|nph       IGVRQYYREKLGYYQDGPYVSTRLDQ
                    **.*:**.::*** ******:..: