HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0351COG1855arCOG04116ATPase (PilT family)twitching mobility related protein

HOG Organism Gene ID Name Annotation
cHOG0351 nrc1 VNG2615 pilT twitching mobility related protein
cHOG0351 hmu HMUK0301 Hmuk_0301 PilT protein domain protein
cHOG0351 hma RRNAC2098 ATPase
cHOG0351 hwa HQ1369A ATPase
cHOG0351 hla HLAC0722 Hlac_722 PilT protein domain protein
cHOG0351 hbo HBOR27720 Hbor_27720 ATPase, PilT family
cHOG0351 hut HUTA0503 Huta_0503 PilT protein domain protein
cHOG0351 hvo HVO_0421 HVO_0421 P-loop ATPase of the PilT family
cHOG0351 nph NP0198A ATPase
cHOG0351 hhi 2587 HAH_2587 ATPase
cHOG0351 hhi 5312 dsrE intracellular sulfur reduction protein, DsrE/DsF family protein
cHOG0351 hhi 4142 HAH_4142 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4142|hp|hhi         ------------------------------------------------------------
5312|gene|hhi       ------------------------------------------------------------
2615|chp|nrc1       -------------MNVVPDTSVVVDGRISRGVE---------DG-TYEGATVYVPEAVVG
722|gene|hla        -------------MNVVPDTSAVVDGRVSERVE---------DG-TYAAARVLIPEAVVG
1369|gene|hwa       -------------MKVVPDTSAVVDGRVSERVE------------SAETATVVVPEVVVG
27720|gene|hbo      -------------MKLVPDTSAVIDGRVSERVE---------SG-D-AETTVCVPEAVVG
198|gene|nph        -------------MDILPDTSAVIDGRVSERVEE--------DGVD----VVYIPEAVVG
503|gene|hut        MLAFITGAAPPTGMNIVPDTSVIIDGRVSDRIS---------DG-EFADATVAVPEAVVG
12098|gene|hma      ----MNGSLQRSHMEIVPDTSVVIDGRVSDQVKADADPDTDVDGMGFAGATVVVPEAVVG
2587|gene|hhi       -------------MEIVPDTSVVIDGRVSDQVKADADPDTDVDGMGFAGATVVVPEAVVG
                                                                                

4142|hp|hhi         -------------------------MNAAGTATLGDFG-----------------AGGPR
5312|gene|hhi       ---------------------------------MAYIG----------------------
2615|chp|nrc1       EVEAQANGGRQTGWDALEELQRLVELADDGAITVEYVGERADEDDIK-------RAAAGA
722|gene|hla        ELESQANDGLESGWDGLSELKRLADYADEGTIELEYVGERADGDARS-------RAHKGD
1369|gene|hwa       ELESQANDGRETGWDGLEELQQLASLADAGNVDVQYVGDGNTQNELTNGDAASIRDGPAD
27720|gene|hbo      ELESQANQGYDTGWEGLSELQRLTELADEGALTVEYVGRRTKPSEAT-------GAHEGD
198|gene|nph        ELEAQANDGRDSGWDGLEELQQLAALADAGDIDIEYVGRRPDAIEKR-------DAGEGE
503|gene|hut        ELESQANEGRQTGWDGLEELQRLADLADDGEIEIAYIGRRPESSERR-------AADEGD
12098|gene|hma      ELEAQANDGRETGWEGLEELQTLVDLAEEGTIDVEYVGRRPDAIEKR-------EAGEGQ
2587|gene|hhi       ELEAQANDGRETGWEGLEELQTLVDLAEGGTIDVEYVGRRPDAIEKR-------EAGEGQ
                                                     :  .*                      

4142|hp|hhi         SDALI-------------------------------------------------------
5312|gene|hhi       ------------------------------------------------------------
2615|chp|nrc1       IDAIIRDVAAAHDATFVTSDIVQAEVAEGKGIDVEFLEPLEPD-F---EALAIEEYLDED
722|gene|hla        VDALIREVADDYDATLLSSDIVQAEVARAKGIDVEYVEPVARGVV---DELPILEFFTDE
1369|gene|hwa       IDAIIRDVADVENATLLTSDVVQSEVAKAKGITVEYVEPRPRGTASTSGDLAVEDFFDEQ
27720|gene|hbo      IDALIRDIAEEHEATLLTSDQVQAEVARAKGIDVEFVEARTRG-S---GDLVIEEFFDDE
198|gene|nph        IDALIRDLAAEHGATLLTSDVVQSEVAEAKGLPVEYVEPRTED-A---GELAVEAYFDEE
503|gene|hut        IDALIRDLAEDRDATLVTSDVVQSEVAGAKGLDVVYIEPVGRD-V---ESLEIEQFFDET
12098|gene|hma      IDALIRDIAGDRDATLVTSDDVQAEVARAKGLAVEFVDPVKRT-V---DRLQIENFFDEG
2587|gene|hhi       IDALIRDIAGDRGATLVTSDDVQAQVARAKGLAVEFVEPVKRT-V---DRLQIENFFDEG
                                                                                

4142|hp|hhi         --------DTQSAAQEAAAGEWEFLAAGNDTV----------------------------
5312|gene|hhi       ----FLLTGGPFDSER--------------------------------------------
2615|chp|nrc1       TMSLHLKAGMVPKAKRGDVGEIEYQAIGEDALDESLVREYATEIVSTAKRADDAFIELSE
722|gene|hla        TMSVHLKTGTKPKAKRGALGEMRYVVIDEEETSEEQMDEWATAIVDLARQSTDGFIELSD
1369|gene|hwa       TMSVHLKTDTIPKAKRGAIGDMHYQQIAESPTDEPTMKQWADDIEATARSSSDGFVELSE
27720|gene|hbo      TMSVHLKTGTKPKAKRGAIGEMHYQTISEEVSDEETMKAWADDIENSARASPNGFVELAE
198|gene|nph        TMSVHLKTDVPPMAKRGTVGEMRYEHIAEEPLSESEMRSFANDVIDTARTVSDGFVELSQ
503|gene|hut        TMSVHLKVGVAPMAKRGAIGDMHYERIREDVSTEEQLKEFAHEIEESARASPDGFIEIDE
12098|gene|hma      TMSVHLKVGVEPYAKKGSIGDMQYTPIRDSPATESELREYAADIEESARASPDGFLELDE
2587|gene|hhi       TMSVHLKVGVQPYAKKGSIGDMQYTPIRDDPATESELREYAADIEESARASPDGFLELDE
                            .    ::                                             

4142|hp|hhi         ---------GWHI-----------------------------------------------
5312|gene|hhi       ----------WRTA-------------------------YEL------------------
2615|chp|nrc1       DGMTIAQVRDLRIAISEPPFSERVEITAVRPIVKTTMDDYTQADALRERLLERDRGVLIA
722|gene|hla        DGMDIVQFRNYRIAVARPPFADGIEITAVRPIAKTTLDDYEFADELRERFLEQKRGVLIS
1369|gene|hwa       SGMKIVQFRDYRIAVARPPFADGIEITAVRPIVKTELDDYEFADDLRERLEAKQRGVLIS
27720|gene|hbo      PGMSIVQFRDYRIALARPPFSDGIEITAVRPIVKTDLDEYEFADELRDRLSERQRGVLIS
198|gene|nph        PGMTIVQIRDMRIAVAEPPFADGIEVTAVRPIVKTDLDDYESADALRDRFTEHQRGVLIS
503|gene|hut        PGMSIIQFREYRIAIARPPFADGIEITAVRPIVKTELADYEYADELRDRLVERQRGVLIS
12098|gene|hma      PGMTITQFRDYRIAIARPPFSDALEITAVRPIVKTELDDYEYADELRDRFTEHQRGVLIS
2587|gene|hhi       PGMTITQFRDFRIAIARPPFADALEITAVRPIVKTELDDYEYADQLRDRFTEHQRGVLIS
                               .                                                

4142|hp|hhi         --PDTGATVLLK------------------------------HSDAGWTLERAT------
5312|gene|hhi       -----GRAALDQ------------------------GHEVSYFHYLDGALVPVADQTLPG
2615|chp|nrc1       GAPGAGKSTFAQAVAEFLADAGNVVKTMEKPRDLQLDEEVTQYTALSGSMEKTADSLLMV
722|gene|hla        GSPGAGKSTFAQAVAEFLNDNDYAVKTMEKPRDLQVGPEITQYGALGGQMEKTADSLLLV
1369|gene|hwa       GSPGAGKSTFAQAVAEFLTDSDYAVKTMEKPRDLQVGSDVTQYTALGGDMAKTADSLLLV
27720|gene|hbo      GSPGAGKSTFAQAVAEFLNESDYAVKTMEKPRDLQVGPEITQYTALDGQMEKTADSLLLV
198|gene|nph        GAPGAGKSTFAQAVAEFLDDSGFAVKTMEKPRDLQVGPEITQYTELGGSMENTADSLLMV
503|gene|hut        GAPGAGKSTFAQAVAEFLSDSDYSVKTMEKPRDLQVGPEVTQYTELAGSMERTADSLLMV
12098|gene|hma      GSPGAGKSTFAQAVGEFLVDADYAVKTMEKPRDLQVGPNITQYTELGGSMEKTADSLLMV
2587|gene|hhi       GSPGAGKSTFAQAVGEFLVDADYAVKTMEKPRDLQVGPNITQYTELGGSMEKTADSLLMV
                         * :.: :                              .      :  .:      

4142|hp|hhi         --------------------------------KLVGTRRSLDA-----------------
5312|gene|hhi       CSDSGLYDEMPT----EKFQELIADGADVICCGLCVDARGIDAPADYPEGVEVGLLPDLA
2615|chp|nrc1       RPDYTIYDEVRKTDDFEVFSDMRLAGVGMV--GVVHATRPIDALQRLVGRVELGMIPQIV
722|gene|hla        RPDYTIYDEVRKTNDFEVFSDMRMAGVGMV--GVVHASRAIDALQRLVGRVELGMIPQIV
1369|gene|hwa       RPDYTIYDEVRKTKDFSVFADMRLAGVGMV--GVVHATEAIDALQRLVGRVELGMIPQVV
27720|gene|hbo      RPDYTIYDEVRKTDDFEVFADMRLAGVGMV--GVVHATRAIDALQRLVGRVELGMIPQVV
198|gene|nph        RPDYTIYDEVRKTSDFETFADMRMAGVGMI--GVVHATRAIDALQRLVGRVELGMIPQVV
503|gene|hut        RPDYTIYDEVRKTDDFEVFADMRLAGVGMI--GVVHATRAIDALQRLVGRVELGMIPQVV
12098|gene|hma      RPDYTIYDEVRKTDDFEVFADMRLAGVGMV--GVVHATRAIDALQRLIGRVELGLIPQIV
2587|gene|hhi       RPDYTIYDEVRKTDDFEVFADMRLAGVGMV--GVVHATRAIDALQRLIGRVELGLIPQIV
                                                     :      :**                 

4142|hp|hhi         ------------------------------------------------------------
5312|gene|hhi       DII-----GEADRV----------------------------------------------
2615|chp|nrc1       DTVVYIEAGNVETVYDVTTEVKVPEGLMEEDLARPVIQVRDFETNVPAYELYTFNRQVVT
722|gene|hla        DTVVYIEAGEVHTVYDVTTEVKVPAGLTAEDLARPVIQVSNFETGRPEYEIYTFNRQVVT
1369|gene|hwa       DTVVYIEDGHVETVYDVTTEVKVPEGLAAEDLARPVIQISDFETDIPAYEIYTFNRQVIT
27720|gene|hbo      DTVVYIEDGRVDTVYDVQTQVKVPEGLTAEDLARPVIQVTDFETNTPAYEIYTFNRQVVT
198|gene|nph        DTVVYIEAGDVDTVYDVKTEVKVPHGLVEEDLARPVIVIEDFETGVPAYEIYTFNRQVVT
503|gene|hut        DTVVYIEAGEIDTVYDVTTEVKVPEGLMEEDLARPVIVIEDFETGRPEYEIYTFNRQVVT
12098|gene|hma      DTVVYIEAGEVDTVYDVTTEVKVPQGLMEEDLARPVIMVKDFETNRPEFEIYTFNNQVVT
2587|gene|hhi       DTVVYIEAGEVDTVYDVTTEVKVPQGLMEEDLARPVIMVKDFETNRPEFEIYTFNNQVVT
                                                                                

4142|hp|hhi         ------------------------------------------------------------
5312|gene|hhi       ------------------------------------------------------------
2615|chp|nrc1       VPLDGESGGAG-ESGVDKLAKQEVEREIQAATRDRVAVDIRGPNDAVVYVSDDDISHVIG
722|gene|hla        VPLNDEDGEGEAETGVGRIAKQEIEREIRSVAHGHVDVELKGNNKAIVYVSEGDIGTVIG
1369|gene|hwa       VPLDGESSNE--ETGVGRLARQEIEREIRSIARGHVDVELKGQNDAIVYVEEDDISYVIG
27720|gene|hbo      VPLGEEGEGRN-ETGVSRLARQEIEREIRSIARGHVDVELQGQEKATVYVDEDDISYVIG
198|gene|nph        VPLEGAEDESGGETGVERVAKQEIEREIRSVSHGHVDVEIKGGNTAVVWVEDDDISHVIG
503|gene|hut        VPIGESEES---ESGVDRIARQEVEREIRSIADGHVEVEVRGRDRAIVWVEDRDISQVIG
12098|gene|hma      VPLGDDEDEQ--DSGVDRLAKQEVEREIRSIARGHVEVELRGPNTAVVWVEDDDISQVIG
2587|gene|hhi       VPLGDDEDEQ--DSGVDRLAKQEVEREIRSIARGHVEVELRGPNTAVVWVEDDDISQVIG
                                                                                

4142|hp|hhi         -------------GLELASSYMADRPEGASAWR---------------------------
5312|gene|hhi       ------------------------------------------------------------
2615|chp|nrc1       KGGGRIADIENRLGIDIDVRTLDERPTESAADPDSDTDDA-------------QAGEIVT
722|gene|hla        KGGGRISDIENRLGIEIDVRTHDQKPGGREGGSGGDGRGANGQGDGQGGQVGEERGTVVT
1369|gene|hwa       KGGGRIADVEDRLGIDIDVRTHEENSSNHRGDGGSSQGTASSDSNPRDTA---DDTMTVT
27720|gene|hbo      KGGGRISDIEDRLGIDIDVRTHEENPSQSAASSGTSGGG--------------DQGEIVT
198|gene|nph        KGGGRISQIEDRLGIDIDVRSFSDRSDGRSGSGSSASGSGV------------AGGETVV
503|gene|hut        KGGGRISDVENRLGIDIDVRTFDERPGGKRRGSASGSSGGGSSSS--------SAGVAVT
12098|gene|hma      KGGGRISDVENRLGIDIDVRTFEERPSGPSGGPQTDSGG--------------KQGEIVQ
2587|gene|hhi       KGGGRISDVENRLGIDIDVRTFEERPSGPSGGPQTESGG--------------KEGEIVQ
                                                                                

4142|hp|hhi         ------------------------------------------------------------
5312|gene|hhi       ---------VSL------------------------------------------------
2615|chp|nrc1       PEITSRHIIVPMGDDRAGETVEVQADGEYLFTATVGRGGDIKVSRGSTIAEELERAIDTE
722|gene|hla        PEITSRHVVIAV-DAGVGETVEVRADGEYLFTATVGRGGEVQVSRGSAIAEELEDAIDRK
1369|gene|hwa       PEVTSRHVVVRL-DEHVGETVEIRADNEYLFTATVGRGGDIQVSRGSAIADDLETAIDRR
27720|gene|hbo      PEVTSRHVVVRM-DDHVGETVEVRADGEYLFTATVGRGGDIQVSRGSAIADELEQAIDRK
198|gene|nph        PEVTSRHVVIPL-DDHHGETVEVRADDEYLFTATVSRGGEIQVSRGSAIAEELEQAIDRG
503|gene|hut        PEITSRHVIVPA-DGHAGETVEVQADGEYLFTATVSRGGEIQVSRGSAIAEELELAIDRS
12098|gene|hma      PEVTSRHVIVPL-DGHAGDTVELQADGEYLFTATVSRGGEIQVSRGSGIAEELERAIDRG
2587|gene|hhi       PEVTSRHVIVPL-DGHAGDTVELQADGEYLFTATVSRSGEIQVSRGSGIAEELERAIDRG
                                                                                

4142|hp|hhi         ---------
5312|gene|hhi       ---------
2615|chp|nrc1       RMITVVPNA
722|gene|hla        RTVTVVPAR
1369|gene|hwa       AQITVHPT-
27720|gene|hbo      QRITVHPA-
198|gene|nph        RQIAVVPQ-
503|gene|hut        QQIVVSPS-
12098|gene|hma      STITVVPS-
2587|gene|hhi       STITVVPS-