HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0350arCOG04625hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0350 nrc1 VNG1417 vng1417 no entry
tucHOG0350 hmu HMUK2212 Hmuk_2212 conserved hypothetical protein
tucHOG0350 hma RRNAC0994 hypothetical protein
tucHOG0350 hwa HQ2408A hypothetical protein
tucHOG0350 hla HLAC1527 Hlac_1527 hypothetical protein
tucHOG0350 hbo HBOR13780 Hbor_13780 hypothetical protein
tucHOG0350 hut HUTA2942 Huta_2942 conserved hypothetical protein
tucHOG0350 hvo HVO_2867 HVO_2867 conserved hypothetical protein
tucHOG0350 nph NP2996A hypothetical protein
tucHOG0350 hhi 1621 HAH_1621 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2408|hp|hwa       -------------------------------MKIRGQRQCSECGHEWSYFDTGQVACPAC
13780|hp|hbo      -------------------------------MEIRGRRRCKSCGHEWSYYDTGEVACPAC
1417|hp|nrc1      MPGFPTPREIGRWSVRRRATGVIPPPGQRRSMDVRGERECKSCGTRWSYFETGSVECPSC
2996|hp|nph       -------------------------------MKVRGRRECKACGTRWSYYDTGDTACPSC
1527|hp|hla       -------------------------------MKVRGERECRECGVRWSYYKTGSVECPDC
2942|chp|hut      -------------------------------MRIRGERECQNCGSRWTYYETGSVECPDC
10994|hp|hma      -------------------------------MKVRGERECQDCGTRWRYYETGSIACPDC
1621|hp|hhi       -------------------------------MKVRGERECQDCGTRWRYYETGSIACPDC
                                                 * :** * *  **  * *:.**.  ** *

2408|hp|hwa       GSLKSVGRGE-RKTHTDSAIELDLSAHQQALDAETD--VSMIAEGLTTTLRDYIRQRGFL
13780|hp|hbo      GSMQSVGIGD-RMQHTDSAEELDLAPHRNALDDES---LTDVTAGLQSDLRAYLRARGFI
1417|hp|nrc1      GSRRSVGVGE-RETHTDTADALDLTAAQ-RAGSED---VLDALEPATEACREYCRSRGFV
2996|hp|nph       GSLHSVGTDDERKLHTATAATLDLTPVREAVDDVP---LRRLATRAIERTREFTRGYGFI
1527|hp|hla       GSLRSVGVDD-RTAHTDAPATLDLSAHRARFGDARGTLPEEGVDDLKDDLREYARRRGFI
2942|chp|hut      GSVRSVGVDE-RTRHTASPVTLELTPAREMIDVEP---PERVADRAAECAAEFVRRDGFI
10994|hp|hma      GSIHSVGIDE-HTEHTDAPATLDLTPVRSRIDADT---TREVADAAAERCREYTRKRGFI
1621|hp|hhi       GSIHSVGIDE-HTEHTDAPATLDLTPVRSRIDADT---TREVADAAAERCREYTRKRGFI
                  ** .*** .: .  ** :.  *:*:. .   .                    : *  **:

2408|hp|hwa       NGGTLQPPDDTLLSAAELLHAVDVLDRCRHPTDEARLYVTKLLGVANDGHRPTPNSVPTS
13780|hp|hbo      RGGDLRDIDDTYLTVRELLHAADVLSRLRDPDEETQLYVLSLLRGADQGERPKPEAVPSV
1417|hp|nrc1      SGGTLLDLDDTYLAAAELWRVGVVLAGQHAISDDEQRHVVALLHGAADGDRPTPAAVPAS
2996|hp|nph       DGGSLQPLDETYLAAMELRYVAGELERRFDPTDEETLYLTTLFK-ADKGVRPDVGDVPSE
1527|hp|hla       RGGELLPLDDTYLAARELLEAVDLYDRLRDPTDRDREYLLALLAGADDGDRPATKAVPDS
2942|chp|hut      DAGDLQPLGATFVAAMELKHVGRAIARSMTVTDDEERFLLALLDGAASGQRPAPDSVPET
10994|hp|hma      DAGELRPLDPTFVAAVELQHVGAHLARELRSGDPAERYFYELLGGADDGDRPAVDEVPSA
1621|hp|hhi       DAGELRPLDPTFVAAVELQHVGAHLARELRSGDPAERYFYELLGGADDGDRPAVDEVPSA
                   .* *   . * ::. **  .           :    ..  *:  * .* **    **  

2408|hp|hwa       LTTARGLAYTEVLSTFHQDFTKWITEESSVMDGSVQSVTEMQESD----------VSIHQ
13780|hp|hbo      LSEARGLAYAESLAAYRRDFSTWLEDHPD--------------------------PEARK
1417|hp|nrc1      LRGPRGLAAAAAVDAYRTDVRAYCGGDVP--------------------------MPERD
2996|hp|nph       LRAMRGLAYADAVDAYRSDLKAYLDDQPD--------------------------PVVGG
1527|hp|hla       LREARGMAAVRAVDEYRTDLLAFLDELAGVDTVEAVGESETASVSVTGDDLLARIDPARA
2942|chp|hut      LVPVRGLAAAATVSEYRRDLRQYLDDDPD--------------------------ERART
10994|hp|hma      LRVPYGLAMSAAVDSYQRDVRTYLDANSE--------------------------PTARQ
1621|hp|hhi       LRVPYGLAMAAAVDSYQRDVRTYLDANSE--------------------------PTARQ
                  *    *:*    :  :. *.  :                                     

2408|hp|hwa       LRERLDTYLTRSEALQGDIPVETSERFVIIARKLHHGVVNHDTDALETARMKLNSVSFDS
13780|hp|hbo      TLATLGEHIKRVEALQGDVPVEESETLVRTARELAAYARDGDESALTTARDRLSRLA---
1417|hp|nrc1      LLERAREHGRRVDALDGEVDPQDSARLVAAVRAIGDAL-RGDEAGIERARTRLNALG---
2996|hp|nph       HVERLADRVRRIQALDGDVPSRQAESLVAVARDIGRYIADGDENALARADERL-DTDPTR
1527|hp|hla       LLERLRDRTKRVEALTGDVPPHDADALVDAANSLGEYVRTGDKTALNRARDRLSDTSDTE
2942|chp|hut      VLGAVEDHRTRVAALDGDVSPAQAEALIEAARAVGTHLIEDDPDALDRARDHLSELDPER
10994|hp|hma      LSGRIRDHRKRVEALDGDVDPADANRLVHAARDLGSYI-TGDESAFVRAENWLTGIEDDT
1621|hp|hhi       LSGRIRDHRKRVEALDGDVDPADANRLVHAARDLGSYI-TGDESAFVRAENWLTGIEDDT
                            *  ** *::    :  ::  .. :       *  .:  *  .*       

2408|hp|hwa       PAAE
13780|hp|hbo      ----
1417|hp|nrc1      ----
2996|hp|nph       AEEF
1527|hp|hla       TNHH
2942|chp|hut      ----
10994|hp|hma      V---
1621|hp|hhi       V---