HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0035COG1132KOG0058 KOG0054 KOG0055 KOG0057arCOG02841ABC-type multidrug transport system ATPase and permease componentsABC transport protein

HOG Organism Gene ID Name Annotation
cHOG0035 nrc1 VNG0123 trp1 ABC transport protein
cHOG0035 hmu HMUK0417 Hmuk_0417 ABC transporter related
cHOG0035 hmu HMUK0402 Hmuk_0402 ABC transporter related
cHOG0035 hma RRNAC2314 trp3 ABC transport protein
cHOG0035 hwa HQ1138A ABC-type multidrug/lipid transport system,permease and ATP-binding protein
cHOG0035 hla HLAC0078 Hlac_78 ABC transporter related
cHOG0035 hla HLAC0913 Hlac_913 ABC transporter related
cHOG0035 hbo HBOR27240 Hbor_27240 ABC-type multidrug transport system, ATPase and permease component
cHOG0035 hbo HBOR38350b Hbor_38350 branched-chain amino acid ABC-type transport system, permease component
cHOG0035 hut HUTA2936 Huta_2936 ABC transporter related
cHOG0035 hut HUTA1262 Huta_1262 ABC transporter related
cHOG0035 hut HUTA1375 Huta_1375 ABC transporter related
cHOG0035 hvo HVO_0506 HVO_0506 trp ABC transport protein
cHOG0035 nph NP0006A ABC-type transport system ATP-binding protein
cHOG0035 hhi 2770 HAH_2770 ABC transporter-like protein
cHOG0035 hhi 633 kptA RNA 2'-phosphotransferase
cHOG0035 hhi 4291 HAH_4291 ABC transporter-like protein
MUSCLE (3.6) multiple sequence alignment


633|gene|hhi        --------------------------------------------------------MPDA
1375|gene|hut       MSWGFSGGNDDADTFEHLREGVDRPMWRLLGNYGRGYIPEFVLGGVASVVARFLELIPAL
12314|gene|hma      --MDFDAGSDD-DVFEDARERVDRPMLRLFTGYGQGHWGAFVVGLCSSIVARMLDLLPPI
2770|gene|hhi       --MDFDAGSDD-DVFEDARERVDQPMLRLFTGYGRGQWGAFVVGLCSSIVARMLDLLPPI
123|gene|nrc1       MSTAPDNEGDD-DPFEEQRADVDNAMVQLFDEYGRDHSFQAVVAVLASVFARVLDLAPPV
1262|gene|hut       ---MSIDLDDD-EVFEDVRDRADRPMRRLFSEYGGRYSFPFVIGFVSSVAARILDLLPPL
1138|gene|hwa       --MDAVPADDD-DPFESQRERVSNPMRRLFSTYGRENIPAIAVGVISSIAARVLDLLPPV
27240|gene|hbo      ---MVTPADED-DPFEDQRENVENPMRRLFSEYGRDNTFAFVIGLLSSVVARLLDLMPPV
6|gene|nph          --MADIAWDDD-DPFEEQRANTDDPMGRLFSAYGRPHILPATVGVIASIAARLLDLLPPV
78|gene|hla         --MSSAEWEDD-DPFEEQRDKIENPMKRLFLAYGRDYLPQVSVGIFASVFARLLDLLPPL
2936|gene|hut       --MSTDDHVDI-EYIERYRDAVEHPLWQLFQRYGHGSRRWFLVGILASIGSRFASLVPPV
913|gene|hla        --MAAD---DR-NAFEVYRDRVDRPLLRLFREYGALEAHWLAIGMAANVIARVAGLVPPV
38350|gene|hbo      -MSSDKPDPNE-RELGAHQELVTSPLFRLFREYGRPEAKWLTLGLLASLGAHGATLVTPL
4291|gene|hhi       -MTEENTGGDG-STIDELGRDIEQPLRSLFVRYGRTKQRRLALGLFASVVSRGAGLVTPI
                                                                             .  

633|gene|hhi        VRRCSEDGFFEGD-----------------------------------------------
1375|gene|hut       VLGVAIDALFVGG-QDFT----LPLVPQSVIPADEPGQFWFAVGLVGAVYLLSAGLNWVN
12314|gene|hma      LLALAIDAIFLQE-AEYG----LFLIPDAWIPNGQGPQLWLTAGIIAASFGLGAVFHWSR
2770|gene|hhi       LLALAIDAIFLQE-VEYG----LFLVPDAWIPSGQGPQLWLTAGIIAASFGIGAVFHWSR
123|gene|nrc1       LLGLAIDSVIQGN-KAF-----LPFLPQSVVPSSKPDRLLFMGGLIAGSFLLGAAFHWIR
1262|gene|hut       LLTLAIDAIF-DD-QQYS----LWLVPQSLIPKTQSAQLWLTVGIIAAAFLIGAGFHWTR
1138|gene|hwa       LLAVAVDAIFLDE-RTFS----LWFVPAAWIPTDQVGQLYISVALIAGAFFGAAGFHWTR
27240|gene|hbo      LLTLAVDSIFLGE-RDFS----IWLIPDAWLPTTKLGELYLSTGLIAFAFFGGAAFHWTR
6|gene|nph          LLGLAIDAVFNDD-AAFA----MWLIPDAWLPAEESEQLLFVVGLIGGAFVLSAGFHWVR
78|gene|hla         MLGIAIDAVFYED-ALFSEQIPLVILPDAWLPTGQTEQFWFTIAVIGAAFGIGAGFHWIR
2936|gene|hut       LLGVALDAIFGSE--SFA----LPLIPGTVLPNETMDQFWFVIALMAVFMIGQAILNFVR
913|gene|hla        VLGVAIDAVFTGT-GPYT----LPIVPDAWLPTAGPAQFRLSVALIVGSFLITGVFTWIY
38350|gene|hbo      VLGTTIDAVFTSDPSPYR----LPLVPVAWLPTKQTTQFWLSAALVAASLVTTASLTWVR
4291|gene|hhi       VLGTTIDAVFNNE-GAYT----LPLVPSAWLPSDATSQFWLSALLVGGSLVLVALTAWLR
                    :   : *..:                                                  

633|gene|hhi        ---------------ACPVCDREGTLVLD-------GERRRQLSK-------FTSGALRH
1375|gene|hut       GWAWNRFAQHLQHEVRVDTYDVVQRMRMGFFDDKQTGEVMSILNNDVNQLESFLTNDLNA
12314|gene|hma      NWGWNKFAQHVQHAVRTDTYETMQRLNMDFFADKQTGEMMSVLSNDVNRLEKFLNDGLNS
2770|gene|hhi       NWGWNKFAQHVQHAVRTDTYETMQRLNMDFFADKQTGEMMSVLSNDVNRLEKFLNDGLNS
123|gene|nrc1       NWGFNSFSQHIQHRVRTDTYDKMQRLNMDFFATKQTGEMMSILSNDVNRLERFLNDGLNS
1262|gene|hut       NWGWNTFAQNIQHNVRTDTYDKMQRLNMDFFADKQTGELMSILSNDVNRLERFLNEGMNA
1138|gene|hwa       NWGWNAFAQRVQHAVRTDTYNEMQRLSLSFFADKQTGEMMSILSNDVNRLERFLNDGMNS
27240|gene|hbo      NWGWNSFAQNIQHAVRTDTYDKMQRLNMDFFADKQTGEMMSILSNDVNRLERFLNDGMNS
6|gene|nph          NWGFNAFAQRIQHDVRTDTYDAMQRLEMGFFADKQTGELMSILSNDVNQLETFLNEGLNS
78|gene|hla         NWGFNAFAQNIQHDVRTDTYDKMQRLNMEFFSDKQTGEMMSILSNDVNRLERFLNDGMNS
2936|gene|hut       ASSLNLFSHRVKHEVRTATYQRMQRLDMEFFNEVQTGELMSILSNDTNRLERFLDNMFGE
913|gene|hla        GIAANNFAHRVMHAVRTDSFDRMQRLDMTFFDDKQTGEVMSVLNNDASNLEVFLDNALQN
38350|gene|hbo      GVAMNVFAYKVLYEIRTDAYERLQRLDMSFFDNTQTGEIMSVLDNDASNLERFLDNALSQ
4291|gene|hhi       DYMMNDFAHGVMYDIRADSYRKFQELDTVFQEEVDTGEVMSILNNDTTNLERFFDNGLQD
                                             :          **    *.:       *    :  

633|gene|hhi        FP----------------------------------------------------------
1375|gene|hut       GIRISVLVVGVASVMVWLNWQLAIVALLSVPVLAVASYLFVQRIGPKYGRVRRSVGALNS
12314|gene|hma      ASRMIIMVVGIATYLFYMNWQLALVALLPVPIIAVFTKRFIDVIQPKYAEVRSTVGKLNS
2770|gene|hhi       ASRMIIMVVGIATYLFYMNWQLALVALLPVPIIAVFTKRFIDVIQPKYAEVRSTVGKLNS
123|gene|nrc1       AFRLSVMVLAIGVYLFVVNWQLAVLTMLPVPIIALFTYRFVNAIQPKYADVRSSVGHLNS
1262|gene|hut       FFRLSIMVLGISVILFYWNWQLALVTLGVVPLIGFFTYKFVETIQPKYADVRSSVGQLNS
1138|gene|hwa       AFRLGVMVIGIAAILLYWNWQLALVTLSVVPLIGYFTYRFVKIIQPKYADVRSSVGQLNS
27240|gene|hbo      AFRLGVMVIGIAAILLYWNWQLAIVTLLVVPLIGYFTYRFIQTIQPKYADVRSSVGRVNS
6|gene|nph          MFRLGVMVVGIGAVLLYYNWQLALVALLPVPLIAGFTYLFVKVIQPKYARVRSSVGTVNS
78|gene|hla         LFRLSVMVVGIGVLLFWINWQLALVALLPVPIIGGFTYLFIKIIQPKYAEVRSSVGKMNS
2936|gene|hut       SIQLGVLIVGISLILFWFNGQLAVVTLAVIPLAAVFTYWFMRLAEERYTDVRQSVGDLNS
913|gene|hla        SARLGVMLVGIAGVLFYYNHELAVVTLSVIPLMILFTVWFMRAVEPRYVAQRSVVGDLNT
38350|gene|hbo      SVRIFAIVVGISAALFHTNTQLAVVTLVAVPFLVGFTWWFMRLVEPRYARLRAEIGNLNT
4291|gene|hhi       MVRIGVMVVGVTGILLHLNYQLAVITLLALPLFIGFTWWFTQAVEPRYAGWRSSVGHLNT
                                                                                

633|gene|hhi        -------------------------EDAGIEVDEAGWTAFAS------------------
1375|gene|hut       RLENNIGGIEVVKSYGRESFERDRVEEASEEYLDANWDAITTRIKFFPTLRIITGLGYMF
12314|gene|hma      RLENNLSGIQIIKTANTEPYEADRVEDTSEDYLDANWDAIETRITFFPGLRLVSGIGFVV
2770|gene|hhi       RLENNLSGIQIIKTANTEPYEADRVEDTSEDYLDANWDAIETRITFFPGLRLVSGIGFVV
123|gene|nrc1       RLENNLGGIQVIKTSNTERYESDRVDDVSQGYFDANWGAITIRIKFFPALRIISGVGFVL
1262|gene|hut       RLENNLGGIQVIKAANTETFESDRVDDVSEDYFDANWDAIGTRIKFFPGLRLLSGVGFVV
1138|gene|hwa       RLENNLGGIQVIKSAHTENFESDRVDDTSQEYFDSNWDAIKTRITFFPALRILSGVGFVL
27240|gene|hbo      RLENNLGGIQVIKTSNTESFESDRVEDVSQDYFDANWDAIGTRIKFFPALRVMAGVGFVL
6|gene|nph          RLENNLGGMQVIKTATTEEYESDRVDAVSSEYLDANWDAIGTRIKFFPALRLLAGLGFVL
78|gene|hla         RLENNLGGIQVIKSSNTEPYESDRVDDVSMDYFDANWDAITTRIKFFPALRVLAGIGFVL
2936|gene|hut       RLENNLNGIEVIKSANTEDHEDKRVREHSYQYFRLDWLALRLNFIYRPGLQALTSISFIA
913|gene|hla        ALENALAGVELVKTSHTEAHESDRVETASQQYFERTMSILRLNYVYRPGMELFAGLAFAA
38350|gene|hbo      QIENGISGIELVKTANTAAHENERMDEVSHNLFEARVDVSKLTFLYRPGMKLLTGASLLA
4291|gene|hhi       RLQNAISGSLLVKTAPAKGYEANRIDNAAKDLYDDAISAIRLSVVYRPGMRFLTGLILFA
                                                .                               

633|gene|hhi        -----------------------------LQAAVE-----------RKYDW---------
1375|gene|hut       TFLVGGYWLLF-----GPPSVSLAGTTVGFTGGMTLGVLTPMLLYARRFLWPMRQFGNVV
12314|gene|hma      TFIVGGLMVTG-----QAPG--------PLTASLSRGQFVAFIIYTQRFVWPMAQFGQII
2770|gene|hhi       TFIVGGLMVTG-----QPPG--------PLTASLSRGQFVAFIIYTQRFVWPMAQFGQII
123|gene|nrc1       TFVIGGIWVAT-----GPPM--------FFSGTLDPGEFVTFILLSQQFIWPMAQFGQII
1262|gene|hut       TFLVGGLWVFTSQTTGTGPW--------FFTGKLSVGEFVGFILLSQRFIWPMAQFGQII
1138|gene|hwa       TFLIGGAWVLTYQQTGQAPL--------FFSGSLTPGEFVGFILFTQRFIWPMSQFGQII
27240|gene|hbo      TFVVGGVWVHTYQTTGSAPL--------FFSGALTPGEFVGFILFTQRFIWPMAQFGQII
6|gene|nph          TFVVGGLWVIT----GSGPG--------PLTGDLTVGTFVVFILFTQRFVWPLAQFGQII
78|gene|hla         TFVIGGLWVFQ----DTPPG--------PFTGDLSVGMFVVFILYTQRFIWPMAQFGQII
2936|gene|hut       TFVVGGVWILE-----GPPG--------PLTGDLSEGTLVIFLLLTQRLVEPLAQMSTII
913|gene|hla        TFAVGGYWLSA-----GPPG--------PFSTTLTVGTFVTFVLLTQQFVAPLAEVSNII
38350|gene|hbo      TFVVGGVWVFS-----GPPP--------GFSGELSVGDFVVFILLVQQLTAPLAQLSNIV
4291|gene|hhi       TFVVGGTWVFT-----GPPG--------PLTGDLTVGTFVVFMLLTQRLTDPLAKLSDVV
                                                 :   :            ..            

633|gene|hhi        -------ADGEALAGVIATDPK------------------GRF-----------------
1375|gene|hut       NNYRYAFAAAERIVGLMEYPGTVDDPDDAVDLGGVD----GRVSYADVTFQYPEA-----
12314|gene|hma      NMYQRAYASAERVFGLMDTPGRLEEAEDAPPLAVTD----GRVAYEDVVFSYDGD-----
2770|gene|hhi       NMYQRAYASAERVFGLMDTPGRLEEAEDAPPLDVTE----GRVEYDDVSFSYDSD-----
123|gene|nrc1       NMYQRARASSERIFGLMNEPSRIEENPDADELVVDD----GGVVYDDVRFGYD-D-----
1262|gene|hut       NMYQRAHASSERIFGLMDTPSRIVEDPDAEPLAVTD----GHVEFDDVTFGYD-D-----
1138|gene|hwa       NMYQRAYASAARIFGLMDEPARIVNDPDAPALDVDT----GTVQYSDVTFGYETD-----
27240|gene|hbo      NMYQRAYASSARIFGLMDEPSRIEEDPNADELVVDD----GEVVYDDVTFGYD-D-----
6|gene|nph          NMYQRAHASAERVFGLVDESDGLEATGEADPLAVTD----GSVEYDGVTFGYD-------
78|gene|hla         NMYQRARASSARIFGLMDEPSRLAEDPDAEDLTVGD----GDVVYDDVSFGYD-------
2936|gene|hut       DRYEDARASTKRILGIMNLPVDIQDAEDAIELEAVE----GHVQFDDVTFGYA-------
913|gene|hla        DQYENAKASCERVFGLRDIPIRITDGEDAIDLGGKSSSVAGAVEYDDVSFAYAENALVDP
38350|gene|hbo      DWYENARASGKRICGLFDVPVRVRDASDPVALDSAN----GRIEYDDVNFEYD-D-----
4291|gene|hhi       DRYENAKASGKRICGLLRAPTYVTENPDAAVLDSID----GHVEFDTVSFAYGTNN--PE
                           *    : *:                        * .                 

633|gene|hhi        ---ERTGTSDESSTVAAG------GRVRAAYGHSVDVIL---------------DATDDP
1375|gene|hut       ---DEASVDDVSFSAEAGDFVGLVGPTGAGKTTLLKLLVRLYDPEEGEIRVDGHDVRDVS
12314|gene|hma      ---DEPVLSDISFEADGGETVALVGPTGAGKSTVLKLLLRMYDVDSGTVRIDGQNVQDVQ
2770|gene|hhi       ---DEPVLSDISFEADGGETVALVGPTGAGKSTVLKLLLRMYDVDSGTVRIDDQNVQDVQ
123|gene|nrc1       ---DDAIVEHIDFQVDGGDTLALVGPTGAGKSTVLKLLLRMYDVDAGAVRVDGQDISGVT
1262|gene|hut       ---EETIVEDIAFEVEGGDTVALVGPTGAGKSTVMKLLLRMYDVDEGAIEIDGTDLRDAT
1138|gene|hwa       ---EEPTIKDISFEIPGGETLALVGPTGAGKSTVLKLLLRMYDVDEGAITVDGTDVREIT
27240|gene|hbo      ---GETIVEDISFDVDGGETLALVGPTGAGKSTVLKLLMRMYDVDEGSIEIDGTDIRDVT
6|gene|nph          ---GETVVENIDFEADGGETVALVGPTGAGKSTVLKLLLRLYDVDEGAIRIDGQDIRSAT
78|gene|hla         ---EETIVSDIDFAVEGGETLALVGPTGAGKSTVLKLLLRMYDVDEGSIRIDGQDVRDVT
2936|gene|hut       ---EQAVLEDIDVDVEPGETVGLVGPTGAGKTTFVKLLLRLYDVDEGAVRVDGHDVRDVT
913|gene|hla        ADADEEVIRNVSFEANPGDTVALVGPTGAGKSTLLKLLLRLYDVTEGAVRVDGHDVRNLT
38350|gene|hbo      ---GEQVLNGVDFTAQPGETIALVGPTGAGKSTVAKLLLRLYDADTGAVRVDGHDVRDIR
4291|gene|hhi       SSADEPVLADISFTLNPGETVALVGPTGAGKSTIAKLLLRLYDVTSGEIRADGHDIREVT
                                     *      * . *.     .:::               :     

633|gene|hhi        IPAT------------LYHGTVPRNV------------------------ASIRETGLKP
1375|gene|hut       LASLREHVGYVSQEPYLFHGTVAENVAYG-IDAGD---------------DEIREALSMA
12314|gene|hma      IQSIRRAIGYVSQETFLFYGTVRENIAYGTFDATD---------------EEIVAAAEAA
2770|gene|hhi       IQSIRRAIGYVSQETFLFYGTVRENIAYGTFDATD---------------EEIVAAAKAA
123|gene|nrc1       LPSLRRHVGYVSQDTFLFYGTVEENITYGTFDADR---------------EAVVDAAKAA
1262|gene|hut       IPSLRQALGYVSQETFLFYGTVRENIEYGTFDAEK---------------EAVVEAAKMA
1138|gene|hwa       IPSLRESIGYVSQDTFMFYGTVAENIRYGTFNASR---------------DEIIDAAKTA
27240|gene|hbo      IPSLRQAIGYVSQDTFMFYGTVEENIRYGTFDAAQ---------------EDVVEAAKAA
6|gene|nph          PTSLRRHIGYVGQDTFLFYGTVRENIAYGTFDADE---------------SDIEAAAKAA
78|gene|hla         LKSLRRSIGYVGQSSYLFYGTIRENITYGTFEATD---------------EEVREAAEAA
2936|gene|hut       LSSLRNSIGYVGQENFLFDGTVAENIKYGAFDADR---------------EAVIEAAKRA
913|gene|hla        VESLRSNVGYVAQDTTLFDGTIAENIRYGRFTGVDTEGRSAGADAKSEVRDRVIEAAKAA
38350|gene|hbo      LGDLRESIGYVSQGTVLFDGTVAENIRYGRFEVSD---------------EAVREAARVA
4291|gene|hhi       LGSLRESIGYVNQEPFLFDGTVAENIRYGQSQASD---------------EAVRQAARAA
                                    :: **:  *:                          :  :   .

633|gene|hhi        ----------------MGRQTVHLSDSVAAAREVGRRHATEPVVFVVDAAAMQAD-----
1375|gene|hut       GAMEFVTELPEEIDTMVGERGVKLSGGQRQRVAIARAILEDPEILILDEATSHVDNETEV
12314|gene|hma      EADQFVRNLPDGYDTMVGERGVKLSGGQRQRIAIARAILKDPEILILDEATSDVDTETEM
2770|gene|hhi       EADQFVRNLPDGYDTMVGERGVKLSGGQRQRIAIARAILKDPEILILDEATSDVDTETEM
123|gene|nrc1       EAHEFIQNLPDGYDTEVGERGVKLSGGQRQRIDIARAILKDPEILVLDEATSDVDTETEM
1262|gene|hut       EAHRFIQNLPDGYDTKVGERGVKLSGGQRQRIALARAILKDPEILVLDEATSDVDTETEM
1138|gene|hwa       EAHEFVMNLPDGYDTEIGERGVKLSGGQRQRLSIARAVLRDPEILILDEATSDVDTETEM
27240|gene|hbo      EAHDFIQNLPDGYDTEIGERGVKLSGGQRQRLSIARAILKDPEILVLDEATSDVDTETEM
6|gene|nph          EAHEFITNLPEGYETMVGERGVKLSGGQRQRIAIARAVLKDPAVLVLDEATSDVDTETEL
78|gene|hla         EAHEFIKNLPEGYDTMVGERGVKLSGGQRQRVTIARAVLKDPDLLILDEATSDVDTETEM
2936|gene|hut       QAHEFITNMPEGYDTEVGERGVKLSGGQRQRVAIARTLLQGPAITVFDEATSAVDTETEL
913|gene|hla        EAHEFIDSLPNGYDTRIGERGVKLSGGQRQRVAIARVVLQDPAILILDEAISAVDTETEM
38350|gene|hbo      EAHAFIEELSSGYDTQVGERGVKLSGGQRQRIALARAVLQDPDIIVLDEATASVDTETEA
4291|gene|hhi       QAHEFVENLRDGYGTEVGERGVKLSGGQRQRIALARVFLQDPDVVVLDEATASVDTETEL
                                    :* . *:**..      :.*     * : :.* *   .*     

633|gene|hhi        -----------------------------------DRRIVKRGTETY-------------
1375|gene|hut       LIQRSLETLTADRTTFAIAHRLSTVRDADTILVMDEGRVVERGTHEDLLAADGLYANLWS
12314|gene|hma      LIQRSLDDLTADRTTFAIAHRLSTVKDADTILVVEDGRIVERGSHAELLAADGLYANLWA
2770|gene|hhi       LIQRSLDDLTADRTTFAIAHRLSTVKDADTILVVEDGRIVERGSHDDLLAADGLYANLWA
123|gene|nrc1       LIQRSLDRLTEDRTTFSIAHRLSTIKDADQIVVLEDGEIVERGTHADLLGDEGLYANLWG
1262|gene|hut       LIQRSLDKLTADRTTFAIAHRLSTIKDAEKIVVIEDGRIVERGTHEDLLADDGLYAKLWA
1138|gene|hwa       LIKRSIERLTADRTTFSIAHRLSTIKDADQILVLDDGEIVERGTHTDLLGADGLYAHLWG
27240|gene|hbo      LIQRSLDRLTEDRTTFSIAHRLSTIKDADQIIVLEDGRVVERGGHDDLLAEDGLYAHLWG
6|gene|nph          LIQRSLDRLTADRTTFAIAHRLSTIRDADTILVLDDGEIVERGTHDELIERDGLYAHLWG
78|gene|hla         LIQRSLDRLTADRTTFAIAHRLSTIKDADTILVLEGGEIAERGTHDELLDNSGLYAHLWG
2936|gene|hut       LIQQSIDDVAADRTTFVIAHRLSTVRDADTILVVEDGRIVERGTHDDLIDADGLYANLWR
913|gene|hla        LIQRSLDELAADRTTFVIAHRLSTVTDADLTLVLEDGGVAERGTHDDLLDADGLYAKLWG
38350|gene|hbo      LIQRSLERVTADRTTVAIAHRLSTIKDADIILVLDDGQIVERGSHEELLAEDGLYANLWG
4291|gene|hhi       LINRSLTELAEERSTIAIAHRLSTVCDADRILVIEDGQIVERGTHKYLLEEDGLYAMLWR
                                                          :.:**                 

633|gene|hhi        ----TTDRVPLGYLSL-----------------------LEK
1375|gene|hut       VQVGEMEALPEEFIERTAERERAGTG-------------DDD
12314|gene|hma      VQAGEIDELPEEFVERAIQRRARTD--------------ADD
2770|gene|hhi       VQAGEIDELPEEFVERAIQRRARTD--------------ADD
123|gene|nrc1       VQAGEIDELPDEFIERAAKRQATVDDQ------------DDD
1262|gene|hut       VQAGEIDELPQEFIERAAERRAQTESE------------ADD
1138|gene|hwa       VQAGEIEELPETFIQRATQRASQTSIETDA---------ADD
27240|gene|hbo      VQAGEIDELPEEFIERASRRASRTPVEPES---------DDD
6|gene|nph          VQAGEIDSLPEAFVERAAERRARADVD------------GDD
78|gene|hla         VQAGEIDELPQEFIDRAQERTARLVEDAES---------DDD
2936|gene|hut       VQAGEIGSLPAEFIEEASQRVAQQGL-------------DGE
913|gene|hla        VQAGEIDELPEEFVERAHERHVDRAVERAMEGETVESETLDD
38350|gene|hbo      VQAGEIESLPDDFFERASQPSL-----------------SND
4291|gene|hhi       IQTGEMDELPERL-----ERHVATDSV------------VTR
                            :*