HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0344COG0459KOG0364 KOG0356 KOG0357 KOG0358 KOG0359 KOG0360 KOG0361 KOG0362 KOG0363arCOG01257Chaperonin GroEL (HSP60 family)thermosome subunit alpha

HOG Organism Gene ID Name Annotation
cHOG0344 nrc1 VNG2226 cctA thermosome subunit alpha
cHOG0344 hmu HMUK0699 Hmuk_0699 thermosome
cHOG0344 hma RRNAC2891 cctA2 thermosome alpha subunit
cHOG0344 hwa HQ3049A thsA thermosome, alpha subunit
cHOG0344 hla HLAC2662 Hlac_2662 thermosome
cHOG0344 hbo HBOR00920 Hbor_00920 thermosome subunit
cHOG0344 hut HUTA1270 Huta_1270 thermosome
cHOG0344 hvo HVO_0133 HVO_0133 cctA Thermosome subunit 1
cHOG0344 nph NP1008A ths_1 thermosome subunit 1 (alpha subunit)
cHOG0344 hhi 157 thsA1 thermosome alpha subunit
MUSCLE (3.6) multiple sequence alignment


2226|gene|nrc1      -------MVLIVTQVLNRIAFNQRVIMAQQMGNQPLIVLSEDSQRTSGEDAQSMNITAGK
1270|gene|hut       ------------------------------MGNQPLIVLSEDSQRTSGKDAQSMNITAGT
12891|gene|hma      MACNRAIHRRSPWLLYRSTFNHRLTMAQQQMGNQPMIVLSEESQRTSGKDAQSMNITAGT
157|gene|hhi        -----------------------------------MIVLSEESQRTSGKDAQSMNITAGT
1008|gene|nph       --------------------------MAQQMGNQPMIVLSEESQRTSGQDAQSMNITAGK
2662|gene|hla       ---------------------MVVMSQRQRMGNQPMIVLSEESQRTSGKDAQNMNITAGK
3049|gene|hwa       ------------------------MSQRMQQG-QPMIILGDDSQRTQGKDAQSMNISAGK
920|gene|hbo        ------------------------MSQRMQQG-QPMIILGEDSQRTQGKDAQSMNITAGK
                                                       :*:*.::****.*:***.***:**.

2226|gene|nrc1      AVAESVRTTLGPKGMDKMLVDSSGEVVVTNDGVTILKEMDIEHPAANMIVEVAETQETEV
1270|gene|hut       AVAEAVRTTLGPKGMDKMLVDSTGNVVVTNDGVTILDEMDIEHPAANMIVEVAETQEDEV
12891|gene|hma      AVAEAVRTTLGPKGMDKMLVDNSGSVVVTNDGVTILDEMDIEHPAANMIVEVAQTQEDEV
157|gene|hhi        AVAEAVRTTLGPKGMDKMLVDNSGSVVVTNDGVTILDEMDIEHPAANMIVEVAQTQEDEV
1008|gene|nph       AVAESVRTTLGPKGMDKMLVDSTGNVVVTNDGVTILGEMDIEHPAANMIVEVAETQEEEV
2662|gene|hla       AVAESVRTTLGPKGMDKMLVDSGGSVVVTNDGVTILKEMDIDHPAANMIVEVSETQEEEV
3049|gene|hwa       AVAESVRTTLGPKGMDKMLVDSGGDVVVTNDGVTILKEMDIDHPAANMIVEVSETQEDEV
920|gene|hbo        AVAEAVRTTLGPKGMDKMLVDNSGEVVVTNDGVTILKEMDIDHPAANMIVEVSETQEDEV
                    ****:****************. *.*********** ****:**********::*** **

2226|gene|nrc1      GDGTTTSVVVSGELLSEAETLLEQDIHATTLAQGYRQAAEKAKELLDDAAIDVSADDTET
1270|gene|hut       GDGTTTAVIIAGELLSKAEDLLEQDIHATILAQGYRQAAEQAKQILEENAIEVTPEDDEI
12891|gene|hma      GDGTTTAVVMAGELLSKAEELLDQDIHASILAQGYRQAAEKAKEILEDNAIDVDADDTET
157|gene|hhi        GDGTTTAVVMAGELLSKAEELLDQDIHASILAQGYRQAAEKAKEILEDNAIDVDADDTET
1008|gene|nph       GDGTTSSVVIAGELLSQAEDLLEQDIHATILAQGYRQAAAEAKAALEEIAIEVDEDDADI
2662|gene|hla       GDGTTSAVVVAGELLDQAEELLDQDIHATTLAQGYRQAAEKAKDILEEEAIEVSEDDRDT
3049|gene|hwa       GDGTTSAVVIAGELLDQAEELIDQDVHATTIAQGFRQAAEKAKEQLDEDAIEVSKEDYDT
920|gene|hbo        GDGTTTAVVIAGELLDQAEDLIEQDVHATTIAQGFRQAAEKAKEVLEGDAIDVSEDDRET
                    *****::*:::****.:** *::**:**: :***:**** :**  *:  **:*  :* : 

2226|gene|nrc1      LEKIAATAMTGKGAENAKGVLSDLVVRAVQSVADDND-VDTDNVKVEKVTGGAIENSELI
1270|gene|hut       LEQIAATAMTGKGAESSKETLAELVVNAVQSVANGED-IDTDNVKVETVVGGSTDESELV
12891|gene|hma      LEKVAATAMTGKGAESSKDVLAELVVRAAQSVVDDDGSVDTDNIQIETVVGGATDESELV
157|gene|hhi        LEKVAATAMTGKGAESSKDILAELVVRAAQSVVDDDGSVDTDNIQIETVVGGATDESELV
1008|gene|nph       LESIAATAMTGKGAEASKDLLAELVVDSVQAVADDGD-IDTDNIKVEKVVGGAVDESELV
2662|gene|hla       LVQIAETAMTGKGAENSKDLLAELVVDSVLAVQDDDS-IDTDNVSVEKVVGSSIDKSELV
3049|gene|hwa       LLEIAETAMTGKGAESSRDLLSELVVDSVLSVADDDS-IDIDNVSIEKVVGGSISNSELV
920|gene|hbo        LVKIASTAMTGKGAESAKDLLAELVVDSVLAVADDDG-IDTDNVSIEKVVGGSIDNSELV
                    * .:* ********* :.  *::*** :. :* :. . :* **:.:*.*.*.: .:***:

2226|gene|nrc1      EGVIVDKERVSENMPYAVEDANIALVDDGLEVQETEIDTEVNVTDPDQLQNFLDQEEEQL
1270|gene|hut       EGVIIDKERVHDNMPYAVEDANVALLDTAIEVQETEIDAEVNVSDPDKLQEFLDQEEAQL
12891|gene|hma      EGVIVDKERVHDNMPFAVEDADVALLDTAIEVPETELDTEVNVTDPDQLQQFLDQEEEQL
157|gene|hhi        EGVIVDKERVHDNMPFAVEDADVALLDTAIEVPETELDTEVNVTDPDQLQQFLDQEEEQL
1008|gene|nph       EGVLVGKERVHDNMPALVEDADIALLDTPIEVKETEIDAEVNVTDPDQLEQFLEQEEKQL
2662|gene|hla       EGVIVDKERVDENMPFAVEDADVALFDGAIEVKETEIDAEVNVTDPDQLQQFLDQEEEQL
3049|gene|hwa       EGVIVDKERVHENMPYMADDANVALFDGALEVRETEIDAEVNVTDPDQLQEFLDQEEAQL
920|gene|hbo        EGVIVDKERVHENMPYMVEDANVALFDGALEVRETEIDAEVNVTDPDQLQQFLDQEEKQL
                    ***::.**** :***  .:**::**.*  :** ***:*:****:***:*::**:*** **

2226|gene|nrc1      KEMVDALKDAGANVVFADSGIDDMAQHYLAKEGILAVRRAKSDDFTRLSRATGATPVSNV
1270|gene|hut       QEMVDQLADVGADAVFCQKGIDDMAQHYLAQEGILAVRRAKKSDIKALSRATGARAVSNI
12891|gene|hma      KEMVDQLAEAGADVVFCQKGIDDMAQHYLAQEGILAVRRAKKSDIEALSRSTGARIISNI
157|gene|hhi        KEMVDQLKEAGADVVFCQKGIDDMAQHYLAQEGILAVRRAKKSDIEALSRSTGARIISNI
1008|gene|nph       REMVDQLADAGADVVFCQKGIDDMAQHYLAQEGILAVRRAKKSDMKALARATGGRVVSNI
2662|gene|hla       REMVDHLVDIGADVVFVGDGIDDMAQHYLAQEGILAVRRAKSDDLKRLARATGGRVVSNL
3049|gene|hwa       QEMVDQFVDVGADVVFVGDGIDDMAQHYLAEEGILAVRRAKSSDLDRLARATDATVVGSV
920|gene|hbo        KEMVDQLVDVGADVVFVGDGIDDMAQHYLAKEGILAVRRAKSSDLKRLARATGGSVVGSL
                    .**** : : **:.**  .***********:**********..*:  *:*:*..  :..:

2226|gene|nrc1      NDIEAADLGAAGSVAQKDIGGDERIFVEDVEEAKSVTLILRGGTEHVVDEVERAIEDSLG
1270|gene|hut       DDITEDDLGFAGSVAQKGVAGDERVFVEDVEDAKAVTLILRGGTEHVVDEVERAIEDSLG
12891|gene|hma      DDIEADDLGFAGSVAQKDIAGDERIFVEDVEDARAVTMILRGGTEHVVDEVERAIEDSLG
157|gene|hhi        DDIEADDLGFAGSVAQKDIAGDERIFVEDVEDARAVTMILRGGTEHVVDEVERAIEDSLG
1008|gene|nph       DDITADDLGFAGSVSQKPIAGDEKIFVEDVDEAKAVTLILRGGTEHVVDEIERAIEDSLG
2662|gene|hla       DDIETDDLGFAGSVAQKDIGGDERIFVEDVEEAKSVTLILRGGTEHVVDEVERAIEDSLG
3049|gene|hwa       DDIEADDLGYAGSVAQKDIGGDERLFVEDVDDARSVTLILRGGTEHVVDELERAIDDSLG
920|gene|hbo        DDIEADDLGFAGSVGQKDIGGDERIFVEDVEEAKSVTLILRGGTDHVVDEVERAIDDSLG
                    :**   *** ****.** :.***.:*****::*.:**:******:*****:****:****

2226|gene|nrc1      VVRVTLEDGQVMPGGGAPETELAMQLRDFADSVGGREQLAVEAFADALEVIPRTLAENAG
1270|gene|hut       VVRVTLEDGKVLPGGGAPEAELALGLRDHADSVGGREQLAVEAFADAIDVVPRTLAENAG
12891|gene|hma      VVAATLEDGKVLPGGGAPETQLALGLRDHADSVGGREQLAVEAFADAIDVIPRTLAENAG
157|gene|hhi        VVAATLEDGKVLPGGGAPETQLALGLRDHADSVGGREQLAVEAFADAIDVIPRTLAENAG
1008|gene|nph       VVQTTLEDGQVLPGGGAPEIALALALRDFADSVGGREQLAVEAFADAVDVIPRTLAENAG
2662|gene|hla       VVRTTLLDGKVLPGGGAPEAELALQLRDFADSVGGREQLAVEAFADALEVIPRTLAENAG
3049|gene|hwa       VVRTTLEHGQVLPGGGASETELSLHLREFADSVGGREQLAVEAFAEALDVIPRTLAENAG
920|gene|hbo        VVRTTLEDGKVLPGGGSPETELSLQLREFADSVGGREQLAVEAFAEALDVIPRTLAENAG
                    ** .**  *:*:****:.*  *:: **:.****************:*::*:*********

2226|gene|nrc1      HDPIDSLVDLRSQHDGGDTEAGLDAYNGDVIDMESEGIVEPLRVKTQAIESATEAATMIL
1270|gene|hut       HDPIDSLVDLRSQHDAGDIGVGLDAYSGDIVDMSEDGVYEPLRVKTQAVESATEAAVMIL
12891|gene|hma      LDPIDSLVDLRSKHDGGAVTSGLDAYTGEVVDMEEDGVVEPLRVKTQAVESATEAAVMIL
157|gene|hhi        LDPIDSLVDLRSKHDGGAVTSGLDAYTGEVVDMEEDGVVEPLRVKTQAVESATEAAVMIL
1008|gene|nph       LDPIDSLVDLRSQHAEGDDAAGLDAYTGDVIDMEEEGVVEPLRVKTQAIESATEAAVMIL
2662|gene|hla       LDPIDSLVDLRSRHDAGEFGAGLDAYTGDVIDMEAEGVVEPLRVKTQAIESATEAAVMIL
3049|gene|hwa       LDPIDSLVDLRKTHDEGEITSGLNAYTGEVIDMEEDGVVEPLRVKTQAIESATEAAVMIL
920|gene|hbo        LDPIDSLVDLRARHDGGEFGAGLDAYTGEVIDMEEEGVVEPLRVKTQAIESATEAAVMIL
                     **********  *  *    **:**.*:::**. :*: *********:*******.***

2226|gene|nrc1      RIDDVIAAGDLAGGQVGDDDGDDGPAGGP---GGMGGGMGGMGGMGGMGGAM
1270|gene|hut       RIDDVIAAGDLKGGGSDDGDDGGPPAGGPG--GGMGGGMGGMGGMGGMGGAM
12891|gene|hma      RIDDVIAAGDLKGGQGDDDEDEGGPGGPGGAPGGMGGGMGGMG--GGMGGMM
157|gene|hhi        RIDDVIAAGDLKGGQGDDDEDEGGPGGPGGAPGGMGGGMGGMG--GGMGGMM
1008|gene|nph       RIDDVIAAGDLAGGASDDDDDEDMPAGGGGMGGGM-GGMGGMG--GGMGGMM
2662|gene|hla       RIDDVIAAGDLKGGGSDDGGDEGGP-------GGAPGGMGGMGGMGGMGGAM
3049|gene|hwa       RIDDVIAAGDLKGGGTDDDDD--APAGGPGGPGGA-GGMGGMGGMGGMGGAM
920|gene|hbo        RIDDVIAAGDLTGGQTGDDDDDDMPA------GGA-GGMGGMGGMGGMGGAM
                    *********** **  .*. .   *       **  *******  ***** *