HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0343COG3842arCOG00177ABC-type spermidine/putrescine transport systems ATPase componentsspermidine/putrescine ABC transporter ATP-binding

HOG Organism Gene ID Name Annotation
cHOG0343 nrc1 VNG0921 potA1 spermidine/putrescine ABC transporter ATP-binding
cHOG0343 hmu HMUK2275 Hmuk_2275 ABC transporter related( EC:3.6.3.30 )
cHOG0343 hma RRNAC0908 potA4 spermidine/putrescine ABC transporter ATP-binding protein
cHOG0343 hwa HQ2543A sfuC ABC-type spermidine/putrescine/iron transport system, ATP-binding protein
cHOG0343 hla HLAC0472 Hlac_472 ABC transporter related
cHOG0343 hbo HBOR15040 Hbor_15040 ABC-type spermidine/putrescine transport system, ATPase component( EC:3.6.3.30 )
cHOG0343 hut HUTA1874 Huta_1874 ABC transporter related
cHOG0343 hvo HVO_1707 HVO_1707 potA spermidine/putrescine ABC transporter ATP-binding prote
cHOG0343 nph NP3648A abc24a spermidine/putrescine/iron ABC transporter ATP-binding protein
cHOG0343 hhi 1543 sfuC spermidine/putrescine ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


1874|gene|hut       --MTASQHSTPVDAQPRSTGASEPAEKGR-------------AVLELDGVTRQFGAETAV
3648|gene|nph       --MSSELKRTDQSAGPAAAAAGQT-------------------VLELDDVQKSYDGMDVI
1707|gene|hvo       MSNSTLSTTDRSNRAEATDSETDDADAG--------------GVLELDGVSKSYGTESVI
2543|gene|hwa       --MNSSKTTQETRRSPVSDESNHTDE-----------------VLELCDLQKHYGTETVV
15040|gene|hbo      -------MNDQSASASDSETRSESEA-----------------VLELDGLKKSYGTETVI
10908|gene|hma      --MSRQTRTQQTSDFDDVDAAVANPNR---------------TVLELDDVSKDYGHEVAV
1543|gene|hhi       --MSRQTRTQQTSDFDDVDAAVANPNR---------------TVLELDDVSKDYGHEVAV
472|gene|hla        --MAHTQSVKPTQSAGDASESPAEANESHAGATESATDASPDPVLSLSGVTKEFGPETAV
921|gene|nrc1       --MAESASRRHADDTSRSTAEFSGSD----------------TVLELDGVTKEYGAETAV
                                                               **.* .: . :.   .:

1874|gene|hut       ANLDLTVQDGELLTLLGPSGCGKTTTLRLLAGLDEPDAGAIRVAGETVAGEGTFVKPENR
3648|gene|nph       RDLSLDVRDGELLTLLGPSGCGKTTTLRLIAGLERPDNGTVRLGSTPVSGSE-FVPPEQR
1707|gene|hvo       DDLSLSVEEGEILTLLGPSGCGKTTTLRLIAGLDRPDGGEVRLNGNVVSGGDTFRAPEER
2543|gene|hwa       DHLSLSVNSGEILTLLGPSGCGKTTTLRLIAGLEAVDGGIVRLNGKNVTGSS-FVPPEQR
15040|gene|hbo      HDLSLSVREGEILTLLGPSGCGKTTTLRLLAGLERPDGGAVRLNGRVVSGTE-FVPPEER
10908|gene|hma      ENLSLGVKDGELLTLLGPSGCGKTTTLRMIAGLERPSDGQISIADEVIADGSSFRKPEER
1543|gene|hhi       ENLSLDVKDGELLTLLGPSGCGKTTTLRMIAGLERPSDGQISIADEVIADGTSFRKPEER
472|gene|hla        DGVSLDVNPGELLTFLGPSGCGKTTTLRTIAGLEEPTEGQITLGDETVSGDGAFVPPEQR
921|gene|nrc1       RDLSLSVREGELLTLLGPSGCGKTTTLRMLAGLERPTGGTIELDAQRVAGPDTFVAAEDR
                      :.* *  **:**:************* :***:    * : :    ::.   *  .*:*

1874|gene|hut       DVGLVFQEFALFPHLTVGENVAFGIQDRSDDEIDQRVTDLLELVGLDDYREASPEDLSGG
3648|gene|nph       DVGVVFQEFALFPHLSARENIAFGIQEWSEAEQQERVDELLELVGLVDHGDKSPEELSGG
1707|gene|hvo       GVGVVFQEFALFPHLTAAENIAFGLKDLSESERDERVADLLDLVGLETQGDSYPDELSGG
2543|gene|hwa       GVGVVFQEFALFPHLTARENVAFGLTDHSSAETDHRVDELLELVDLPDQSESYPDELSGG
15040|gene|hbo      GVGVVFQEFALFPHLTARENIAFGLADRSDAETEQRVDELLELVDLPRQGDSYPDELSGG
10908|gene|hma      NVGIVFQDYALFPHLTVAENIAFGLTEMEEDAVAERVDELLELVDLSAHHDKMPSQLSGG
1543|gene|hhi       NVGIVFQDYALFPHLTVAENIAFGLTEMEEDAVGERVDELLELVDLSAHHDKMPSQLSGG
472|gene|hla        DVGIVFQNFALFPHLTVRENIAFGLGD-GADATADRVDEMLDLVDLPEHGEKTPDQLSGG
921|gene|nrc1       EIGIVFQDFALFPHLSVAENVAFGLTDRDEDATAARVDEMLALVDMPEMGDRSVDQLSGG
                     :*:***::******:. **:***: :        ** ::* **.:    :   .:****

1874|gene|hut       QRQRVALARSLAPEPDVLLLDEPFSNLDVGLREEMRREVRRIIKETGVTAVSVTHDQEEA
3648|gene|nph       QQQRVALARSLAPEPKLLLLDEPFSNLDVDLRVEMREEVRDILKEAGVTAISVTHDQEEA
1707|gene|hvo       QQQRVALARSLAPEPAILLLDEPFSNLDVDLRVQMREEVRRILKEAGVTAVSVTHDQEEA
2543|gene|hwa       QQQRVALARSLAPEPDILLLDEPFSNLDVDLRVAMREEVRRILKEAGVTAISVTHDQEEA
15040|gene|hbo      QQQRVALARSLAPEPDILLLDEPFSNLDVDLRVQMREEVRRILKEAGVTAISVTHDQEEA
10908|gene|hma      QQQRVALARSLAPEPDVLLLDEPFSNLDVRLRVEMREEVRKILKRAGVTAISVTHDQEEA
1543|gene|hhi       QQQRVALARSLAPEPDVLLLDEPFSNLDVRLRVEMREEVRKILKRAGVTAISVTHDQEEA
472|gene|hla        QKQRVALARSLAPEPDVLLLDEPFSNLDVRLRVEMREEVRQILKAAGVTAVSVTHDQEEA
921|gene|nrc1       QQQRVAVARSLAPEPDILLLDEPFSNLDVRLRVEMREEVRRILKEAGVTAVSVTHDQEEA
                    *.****:******** :************ **  ** *** *:* :****:*********

1874|gene|hut       LSISDRVAVVRDGRVEQIGRPEIVFQQPESRFVAEFLGQAGFVSGTFAEGCVDTPLGCLD
3648|gene|nph       MSISDRVAVMNNGRIEQVGTPEGVFQQPKSRFVAGFLGHASFVSGYVEDGCVETGVGCVP
1707|gene|hvo       MSISDRVAVMNDGDLEQVGEPEQVFQHPESRFVAGFLGYAGFLPGRIAGDAVETELGTVD
2543|gene|hwa       LSISDRVAVMSDGHIEQVGKPEAVFQHPESRFVASFLGYASFIPGYVSGDVVQTEVGTVP
15040|gene|hbo      LSISDRVAVMNDGNLEQVGEPESVFQHPKSRFVAGFLGYASFIPGYVSGDRVETDLGNLP
10908|gene|hma      LSISDRVAIMNDGTIAQIGDPAEVFENPESRFVASFLGQASFLSARVTNDRIETGLGSFN
1543|gene|hhi       LSISDRVAIMNDGTIAQIGDPAEVFENPESRFVASFLGQASFLSARVTNDQIETGLGSFD
472|gene|hla        LSISDRVAVMNEGQIEQVGRPESVFERPESKFVASFLGRASFLEGHLRDGKVETGIGRFD
921|gene|nrc1       LSISDRVAVLNDGCIEQVGDPEGVFEHPESRFVASFLGQAAFLSARVGSDTVDTAVGSYD
                    :*******:: :* : *:* *  **:.*:*.*** *** *.*: . .  . ::* :*   

1874|gene|hut       ADRIEGLDTEYEGADVDVLVRPDDIRAVPAD--P--------------------------
3648|gene|nph       LEQVNGLTDVYDGSEIDLMVRPDDVCARPAS--P--------------------------
1707|gene|hvo       RDQIHGLAPEYDDTDIDILVRPDDVSAHPCD--G--------------------------
2543|gene|hwa       REQIHGLASEYNQTRIDLLVRPDDVSVCQSN--PDRNDRQTRDHGNMTADGAGAHAQFTN
15040|gene|hbo      REQIHGLAAEYDNTRIDVLVRPDDVSARACE--P--------------------------
10908|gene|hma      VELLNGPVEAYNGAMVDVLVRPDDLQAMPTN--E--------------------------
1543|gene|hhi       VDLLNGPVAAYNGAMVDVLVRPDDLQAMPTN--E--------------------------
472|gene|hla        AVTLEGYDTVYDGTPVDVLVRPDDLRASPAS--A--------------------------
921|gene|nrc1       RALLAGLTDGYQGAMVDVLVRPDDLRAAPVADAT--------------------------
                       : *    *: : :*::*****: .                                 

1874|gene|hut       -----------------------AGTNGRIVDRQYTGPSFVYTVELDSGAILHCEHNHAE
3648|gene|nph       -----------------------EEANGEVVHRRYLGPTVLYRVEIESGDVVGCMHNHAD
1707|gene|hvo       -----------------------GDGHGKVVGKRYLGPTILYEVELHGGDTLLCMHNHDE
2543|gene|hwa       TTKTTSSPISGTTADEYADTQINEYGCGEVVARRYLGPTFLYEVELETGESVQCMHNHDE
15040|gene|hbo      ----------------------GEEPSGRVVARRYLGPTFLYEVELETGERVQCMHNHDE
10908|gene|hma      -----------------------SKADGYVVHRQYNGPSFVYRVELHSGDVVHCMHNHVE
1543|gene|hhi       -----------------------SKADGYVVHRQYNGPSFVYRVELHSGDVVHCMHNHVE
472|gene|hla        -----------------------ELADGTIVSRQYVGPSFIYRVELESGDVVHCLHNHVE
921|gene|nrc1       -----------------------GAGNGTIVKRQYTGPSFIYHVELDNGDVVRCLHNHAD
                                               * :* ..* **:.:* **:  *  : * *** :

1874|gene|hut       ELGMDKRVRVRLATDHPLAWFPAE-----------------------
3648|gene|nph       EVSLDDPVFVSIDADHELAWFPRGERKMADGGPDS---TA-------
1707|gene|hvo       TVPTDGCVEVTLDAGHELAWFPREQR------PESGLYSD-------
2543|gene|hwa       DIPESGVVDIEINADHELAWFPREQR------PDE---TDERYPRGI
15040|gene|hbo      DVPDDGPVAVEIDAGHELAWFPREQR------PEA---EQ-------
10908|gene|hma      TFEPGQPVEVDLVADHDLAWYPTE-----------------------
1543|gene|hhi       TFEPGQPVEVDLVADHDLAWYPTE-----------------------
472|gene|hla        EFDLDESVGLELTADHPLAWYPR------------------------
921|gene|nrc1       NMAIGEPVAVSLVSDHALAWYPTE-----------------------
                     .  .  * : : :.* ***:*