HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0341arCOG04608hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0341 nrc1 VNG1246 vng1246 no entry
tucHOG0341 hmu HMUK2347 Hmuk_2347 conserved hypothetical protein
tucHOG0341 hma RRNAC0805 hypothetical protein
tucHOG0341 hwa HQ2760A hypothetical protein
tucHOG0341 hla HLAC1880 Hlac_1880 hypothetical protein
tucHOG0341 hbo HBOR19060 Hbor_19060 hypothetical protein
tucHOG0341 hut HUTA3026 Huta_3026 conserved hypothetical protein
tucHOG0341 hvo HVO_1324 HVO_1324 conserved hypothetical protein
tucHOG0341 nph NP4180A hypothetical protein
tucHOG0341 hhi 1450 HAH_1450 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3026|chp|hut      --MSIRTDVPPETIGVELTDEGVVVEYADGRETFYHGIPNRAEGAVRTMPGKQVHVLVTD
4180|hp|nph       --MTSRSDIAPETLTVSLESEGVEVEYLDGRSVFYHGVPEKKAGAVHCPPGKDVHVLVTA
1880|hp|hla       MSAPSRSDVPPTSIGIDLREEGVVIEYLDGRTTLYRGVPDAVEGSVTAGPGKETHVLVTD
10805|hp|hma      --MSNRSDIAPDTVSVELTEDGVVVEYLDGRQAFYHGVPTTVEGSIQTAPGKDTHVLITD
1450|hp|hhi       --MSNRSDIAPDTVSVELTEDGVVVEYLDGRQAFYHGVPTAVEGSIQTAPGKDTHVLITD
1246|hp|nrc1      --MSARNDIAPSTLGVELAEEGVYVEYTDGREAFYNGVPEPIEGTLHTNPGKDVHVLVTD
2760|hp|hwa       --MSARNDIAPETVGVELLDHGVAVEYIDGRQTLYRGVPKTVTDSFTTPPGKQTHILVTD
19060|hp|hbo      --MSARNDVPPSTLGVELLDHGVQVEYTDGRTTLYHGVPETVTGTLTTAPGKETHVLVTD
                     . *.*:.* :: :.* . ** :** *** .:*.*:*    .:.   ***:.*:*:* 

3026|chp|hut      ESETAGVLVYVNDRITEAEILESTGVGRVVLEPGEKTTVFPGVRAAN-DARRIVVEADFD
4180|hp|nph       PDETQGVMVYVNDRNTHDDILESTGVGRVIIEGGETASLFPGVAAES-TGYRVEVSADFD
1880|hp|hla       PTETEGVMTYVNDYNTDDEILEDSGVGRVIVEDGERDEVFPGVIVGR-TGQRNEVIADPE
10805|hp|hma      KTETSGILVYVNDLRTHDDILEETGVGRVILDDGEEDELFPGVTVRD-NQMRTAVEVDYD
1450|hp|hhi       ETETSGILVYVNDLRTHDDILEETGVGRVILDDGEEDELFPGVTVRD-NQMRTKVEVDYD
1246|hp|nrc1      PTETEGVLVYVNDLKTHDEILESTGVGRLLLDPGEREELFPGVTVQA-DGYAIDIDADPE
2760|hp|hwa       PTETEGVLLYINDLKTHDNVLESSGVGRVVLEQGSSETVFPGVTVSRLNGMRTTIEADPE
19060|hp|hbo      PTETEGVMMYVNDLKTHDDILESTGVGRVILDAGEEEELFPGVSVRRTEGMRTEIEADPE
                    ** *:: *:**  *  ::**.:****:::: *.   :**** .         : .* :

3026|chp|hut      AVDGRVFVFEEDEMGERSFELVPEGRGE------
4180|hp|nph       VADGRVFVFAEDQMGEFSYELVPESEVA------
1880|hp|hla       IAGGRVFVFVEDGWTEGSYEIVEAPEDGLDAHR-
10805|hp|hma      VTNGRVFVFEEDELGERSYEIVEG----------
1450|hp|hhi       VTNGRVFVFEEDELGERSFEIVEA----------
1246|hp|nrc1      TARGRVFVFAEDELSEYAYEIVGPA---------
2760|hp|hwa       TARGRVFVFVEDDWSEQSYEFVQQTTDSAESHEE
19060|hp|hbo      VARGRVFVFEEDDWGESSYEFVTE----------
                   . ****** **   * ::*:*