HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0034COG0483KOG2951arCOG01349Archaeal fructose-16-bisphosphatase and related enzymes of inositol monophosphatase familyinositol monophosphatase family

HOG Organism Gene ID Name Annotation
cHOG0034 nrc1 VNG1379 suhB inositol monophosphatase family
cHOG0034 hmu HMUK0111 Hmuk_0111 inositol monophosphatase( EC:3.1.3.25 )
cHOG0034 hmu HMUK2222 Hmuk_2222 inositol monophosphatase( EC:3.1.3.25 )
cHOG0034 hma RRNAC1004 H/ACA RNA-protein complex component Gar1
cHOG0034 hwa HQ2795A suhB inositol-1(or 4)-monophosphatase/ fructose-1,6-bisphosphatase, type
cHOG0034 hla HLAC1794 Hlac_1794 inositol monophosphatase
cHOG0034 hbo HBOR18290 Hbor_18290 inositol monophosphatase/fructose-1,6- bisphosphatase family protein( EC:3.1.3.25 )
cHOG0034 hbo HBOR13690 Hbor_13690 inositol monophosphatase/fructose-1,6- bisphosphatase family protein( EC:3.1.3.25 )
cHOG0034 hut HUTA1341 Huta_1341 inositol monophosphatase
cHOG0034 hvo HVO_2857 HVO_2857 suhB extragenic suppressor homolog
cHOG0034 nph NP4188A suhB inositol-1(or 4)-monophosphatase / fructose-1,6-bisphosphatase, type
cHOG0034 hhi 1630 suhB inositol-1-monophosphatase
MUSCLE (3.6) multiple sequence alignment


10040|gene|hma      -------------MKRIGTVSRVAQG----------------------------------
1341|gene|hut       ----MNEIDEETAAEWRSIAREAAESGADIACEYFREGIGNDFKRDQMDPVSKADQEAQE
18290|gene|hbo      MTISPVLSDTRTMTDRVRVAEAAAAAGADVAMAMFERDIETEEKSSKTDVVSEADGAAQD
1630|gene|hhi       ---------MTDASHRAAVAERAARAGGVVAREQFRGDLSVESKANKNDLVTETDRDAQR
4188|gene|nph       ------------MDERADCARRAAEAGADIAAAAFRDGIDSETKGEKTDVVTQADRDAQR
2795|gene|hwa       ----------MTTSERISVARDAARAGAHVAADSFRTKLAIEQKDAKTDVVTQADRDAQT
1794|gene|hla       ---------MADTDERAAVAERAARAGARVANDRFRSDIDVETK-GEDDVVTEADRAAQR
1379|gene|nrc1      ----------MHDTDRVSVAERAARTGGAVALDAFRTGIDVETKSGKTDVVTEADRTAQR
13690|gene|hbo      ----------MENEAKVGVARRAARAGGAVAADRFRTGIDVERKDGKTDVVTQADRDAQS
                                   .   .  .*                                    

10040|gene|hma      --LAVVRA--PDDEYA--------------------------------------------
1341|gene|hut       RIITVLSDRDPDAAIV---------GEEND-----AEKTVPESGPAWIIDPIDGTNNFVR
18290|gene|hbo      EILTTIADHYPDDVVV---------GEEGN-----TPKEIPETGDSWVVDPIDGTSNYLH
1630|gene|hhi       QVVATIRAEFPDDRFLCEEDLSTRAGPEADREPE-AVDSVPDSGSLWVIDPIDGTANYVR
4188|gene|nph       RVVGVIRERYPDEPIV---------GEESDGETEATADELPAEGAAWVVDPIDGTNNFVH
2795|gene|hwa       AVIKSIRETFPEDAIV---------GEEED-----ALKVVPEDDTVWVIDPIDGTNNYVR
1794|gene|hla       TVIESIRETFPDDAIV---------GEEED-----ERKTVPETGAAWVIDPIDGTSNYVR
1379|gene|nrc1      RVVDVIDAVYDEDTIV---------GEEAD-----ALKTVPDAGAAWVIDPIDGTNNFVR
13690|gene|hbo      RVIDVIREEYAADAIV---------GEEED-----ELKQVPSEGAAWVIDPIDGTNNFVR
                      :  :                                                      

10040|gene|hma      -------------------------SVGTTVV----------------------------
1341|gene|hut       GNRLWSVSLARTVDGEPVTAATVLPATGDTYAAGPGVVERNGVECAVSDRTDPSSLIVAP
18290|gene|hbo      GFTVWCQAVAAVRDASPVAAAVTRPAVGDTYVADDTEFRKNGDPTTVSDESDPERFVVAP
1630|gene|hhi       GMRLWGTAVSAVVDGEPVASVTYLPSYGDLYAAGPESGTRDGTELSVSGRTDPETFAVAP
4188|gene|nph       GLREWATSVVAVVDGAAVAGATVAPALGETFLLTPDGAFLNGDPLAVSDRSDPETFTVVP
2795|gene|hwa       GTRTWATVVGVVRDGVVTAGVITLPALNDNYWTDGESAYRNGTPVSVSETTDPEAGVVTP
1794|gene|hla       DIRVWGTAVAAVVDGEPVAAATVAPALGDVYTADTDGAYRNGESMCVSDVSNPRRATVDP
1379|gene|nrc1      DTQLWATAVAAVVDGTPVAACNRFPALEDTYIAGADGATLNGTPISVSEKTDPETFVVAP
13690|gene|hbo      ELRVWGTAVAAVEDGTPVAAATRFPALEDTYWTDGEATYRNSEEVTVSDRDDPEMCVVCP
                                             :                                  

10040|gene|hma      ---------DEELQTVGSVVDVFGPVER--------------------PYLAVSPSDTV-
1341|gene|hut       IFGLKDRDRDDYDDVTSYIHHELGDLRRLGSGQTSMAMVACGEIDAAISTVHMTAWDTVA
18290|gene|hbo      TLRVGDDNRDQYLSVIETCFADLGDLRRIGSAQLTLAMVAAGSIDVALGIGRSHPWDTVA
1630|gene|hhi       VGWWDRDDRDEFGRLCSAVGDRFGDIRRLGSFQATLAHVADGALEGLVCTRPMAPWDTLA
4188|gene|nph       TVWWGFDRRDEYAATCEAIVQQFGDMRRFGSAQLELGYCAAGAVEAVVTNIDPEPWDTVL
2795|gene|hwa       TMWWDFDSRNQYGNACQAIVDRFGDLRRIGSAQAALASVADGSLDAVITNLRTKPWDTLA
1794|gene|hla       TLWWDFDSRDEYAAACEAIVRRFSDLRRFGAAQIVLPTVAAGGLEGTISNLRANPWDSVA
1379|gene|nrc1      TIWWDFDRRDEYAAACAAIVERFGDMRRYGCAQAVLSMVASGQLEATITNVVANPWDSVA
13690|gene|hbo      TIWWGFDERDQYARATNAIVDRFGDMRRFGCAQAVLAMVADGQLDGVLTNVRANPWDSVA
                             ::           :. : *                          . *:: 

10040|gene|hma      --HLPALVGAVLYAR--------------------------------------
1341|gene|hut       GAHMVRAGGGQVTDLSGERWRHDSDSLIATSGEIHEDVLAALRGRLDRE----
18290|gene|hbo      GVHMIRTAGGTVTDLDGNPWRHDSDGLVASNGQAHDAVLDAFDF---------
1630|gene|hhi       GVHMVRRAGGTVTDLDGEPWTHDSDSVVASNGEAHEAFVAAGNEALAED----
4188|gene|nph       GAALVRAAGGTVTDIHGEPWRHDSTGLVASNGRAHDAVLEAARKPERQ-----
2795|gene|hwa       GVAMVRAAGGTVTDLHGDTFRHDSIGLIASNGLIHSNALSAAQSIDHPDADQR
1794|gene|hla       GVFMVRQAGGKATDIEGNRWRHDSTGLVVSNGNLHDEVLDAARAIEGLD----
1379|gene|nrc1      GVHLVRQAGGVVTDIDGTRWTPGATGLVASNGTAHDAVLAAAQEIRAAAE---
13690|gene|hbo      GVHMIRAAGGTVTDLSGDRWQHDSRGLVASNGKIHDSVLEAAREIDGLDG---
                       :    *.