HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0339COG0214KOG1606arCOG04075Pyridoxine biosynthesis enzymeputative stress-induced protein

HOG Organism Gene ID Name Annotation
cHOG0339 nrc1 VNG1793 sip putative stress-induced protein
cHOG0339 hmu HMUK1649 Hmuk_1649 Vitamin B6 biosynthesis protein( EC:4.- )
cHOG0339 hma RRNAC1732 pyridoxine biosynthesis protein
cHOG0339 hwa HQ3323A pyroA pyridoxine biosynthesis protein
cHOG0339 hla HLAC2223 Hlac_2223 Vitamin B6 biosynthesis protein
cHOG0339 hbo HBOR07460 Hbor_07460 pyridoxal phosphate synthase yaaD subunit( EC:4.- )
cHOG0339 hut HUTA0056 Huta_0056 pyridoxine biosynthesis protein
cHOG0339 hvo HVO_2336 HVO_2336 pyridoxine biosynthesis protein
cHOG0339 nph NP4528A pyroA pyridoxine biosynthesis protein
cHOG0339 hhi 2264 pdxS pyridoxal biosynthesis lyase PdxS
MUSCLE (3.6) multiple sequence alignment


4528|gene|nph       -MSNTDLEELRRGTDLVKRGFAKMQKGGVIMDVVTREQARIAEDAGAVAVMHLESVPADI
11732|gene|hma      MTEETDLEDLRRGTDLVKRGFAKMQKGGVIMDVVNREQARIAEDAGAVAVMHLESVPADI
2264|gene|hhi       MTEETDLEDLRRGTDLVKRGFAKMQKGGVIMDVVNREQARIAEDAGAVAVMHLESVPADI
1793|chp|nrc1       MATETDLEELRRGSELVKRGFAKMQKGGVIMDVVNREQARIAEDVGAVAVMNLEAVPADI
3323|gene|hwa       MSEKTDLSELRRGTELVKRGFARMQKGGVIMDVVDAEQARIAEDAGAVAVMALESVPADI
2223|gene|hla       MPEATDLEELKRGTDLVKRGFARMQKGGVIMDVVTREQARIAEDTGAVAVMALEAVPADI
7460|gene|hbo       MPEETDLEELRRGTELVKRGFAQMQKGGVIMDVVDAEQARIAEEAGAVAVMALEAVPADI
56|gene|hut         -MTETDLEDLRRGTDLVKRGFAKMQKGGVIMDVVSPEQARIAEDAGAVAVMALEAVPADI
                        ***.:*.**::*******.***********  *******:.****** **:*****

4528|gene|nph       RKRGGVARMADPGGLEDVIDEVSIPVMGKARIGHTAEAQILEATGADMIDESEVLTQADD
11732|gene|hma      RKRGGVARMADPSKLEEIIEEVSIPVMGKARIGHTAEAQILEAAGADMVDESEVLTQADD
2264|gene|hhi       RKRGGVARMADPGKLEEIIEEVSIPVMGKARIGHTAEAQILEAAGADMVDESEVLTQADD
1793|chp|nrc1       RKRGGVARMADPASLTGIIEEVSIPVMGKSRIGHRKEAEILQAVGADMIDESEVLTPADD
3323|gene|hwa       RKRGGVARMPDPDIVPEIIDEVSIPAMGKSRIGHTKEAEILESLGVDMIDESEVLTPADD
2223|gene|hla       RKRGGVARMPDPENVTEIIDEVSIPVMGKSRIGHRKEAEILESLGVDMIDESEVLTPADD
7460|gene|hbo       RKRGGVSRMADPETVKEIIDAVSIPVMGKARIGHHTEAQILESIGVDMIDESEVLTMADD
56|gene|hut         RKRGGVARMADPADIQEIIDEVSIPVMGKSRIGHTKEAQILEAIGVDMVDESEVLTPADD
                    ******:**.**  :  :*: ****.***:****  **:**:: *.**:******* ***

4528|gene|nph       RYHIDKREFTAPFVCGARNLGEALRRIDEGAAMIRTKGEAGTGDVNQAVTHQRNIQRSIR
11732|gene|hma      RYHIDKREFTAPFVCGARNLAEALRRIDEGAAMIRTKGEAGTGDVNQAVTHQRNIQRSIG
2264|gene|hhi       RYHIDKREFTAPFVCGARNLAEALRRIDEGAAMIRTKGEAGTGDVNQAVTHQRNIQRSIG
1793|chp|nrc1       EYHIDKREFTAPFVCGARNLGEALRRIDEGAAMIRTKGEAGTGDVNQAVHHQRNIKSAIR
3323|gene|hwa       RYHIDKRHFTAPFVCGARNLQEALRRIDEGAAMIRTKGEAGTGDVNQAVHHQRNIKSSIR
2223|gene|hla       EYHTDKRDFASPFVCGARDLPEALRRIREGAAMIRTKGEAGTGDVNQAVKHQRTIKTQIR
7460|gene|hbo       RYHIDKRDFTAPFVCGARNLGEALRRINEGAAMIRTKGEAGTGDVNQAVHHQRNIKGSIR
56|gene|hut         AYHIDKRDFTTPFVCGARNLGEALRRIDEGAAMIRTKGEAGTGDVNQAVHHQRTIKGAIR
                     ** *** *::*******:* ****** ********************* ***.*:  * 

4528|gene|nph       KLSGMDYEERDEWAREHGAPRELVHETAEMGRLPVVNFAAGGIATPADAALMMQLGCDGI
11732|gene|hma      KLEGMAYEERDEWAREHGAPRRLVHETADRGRLPVVNFAAGGIATPADAALMMQHGCDGI
2264|gene|hhi       MLEGMAHEERDEWAREHGAPRRLVHETADRGRLPVVNFAAGGIATPADAALMMQHGCDGI
1793|chp|nrc1       KLEGMDYEERDMWARDHEAPRELVHETAEMGRLPVVNFAAGGIATPADAALMMHHGCDGI
3323|gene|hwa       ELVGKSYEERERWARDHEAPAELVHETAEMGRLPVVNFAAGGIATPADAALMMHHGCDGI
2223|gene|hla       TLTGLNHEEREKWAREHGAPRDLVHETAEAGRLPVVNFAAGGIATPADAALMMYHGCDGI
7460|gene|hbo       KLQGMTHQEREKWAREHEAPAELVHETAEMGRLPVVNFAAGGIATPADAALMMHHECDGI
56|gene|hut         QLEGMSHEEREAWAREHEAPAELVHETAEMGRLPVVNFAAGGIATPADAALMMHHECDGI
                     * *  ::**: ***:* **  ******: ***********************   ****

4528|gene|nph       FVGSGIFGAENPQAMGEAVVAAVNNYDDPETLKEIAKSPGKGMKGQANETLPEEEKLQDR
11732|gene|hma      FVGSGIFGAENPQAMGESVVAAVNNYDDPEQLKEIAKNPGKGMKGQANADLDEEEQLQGR
2264|gene|hhi       FVGSGIFGAENPQAMGESVVAAVNNYDDPEQLKEIAKNPGKGMKGQANADLDEEEQLQGR
1793|chp|nrc1       FVGSGIFGAENPEAMGRAVVDAVNNHDDPERLAEIASNIGEGMQGDPNADLPEDERMQDR
3323|gene|hwa       FVGSGVFGAENPRAMGRAIVEAVNNWDDPDELAQIASNPGKGMKGEANADLSEGEKLQTR
2223|gene|hla       FVGSGIFGAEDPEAMGTAIVEAVNNWDDPDELADIASGIGKGMKGQSNEDLPDEEKLQGR
7460|gene|hbo       FVGSGIFGAEDPEAMGKAIVEAVNNWDNPDQLAEIASGIGKGMKGQSNQDMPEEEKLQGR
56|gene|hut         FVGSGIFGAADPEAMGRAIVEAVNNYDDPERLAEIAAGTGSGMKGDANVDLPEDEQLQGR
                    *****:*** :* *** ::* **** *:*: * :** . *.**:*:.*  : : *.:* *

4528|gene|nph       GI
11732|gene|hma      GV
2264|gene|hhi       GV
1793|chp|nrc1       GN
3323|gene|hwa       GV
2223|gene|hla       GV
7460|gene|hbo       GV
56|gene|hut         GV
                    *