HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0338COG0202KOG1522 KOG1521arCOG04241DNA-directed RNA polymerase alpha subunit/40 kD subunitDNA-directed RNA polymerase subunit D

HOG Organism Gene ID Name Annotation
cHOG0338 nrc1 VNG1136 rpoD DNA-directed RNA polymerase subunit D
cHOG0338 hmu HMUK2592 Hmuk_2592 RNA polymerase insert( EC:2.7.7.6 )
cHOG0338 hma RRNAC0062 rpoD DNA-directed RNA polymerase subunit D
cHOG0338 hwa HQ2941A rpoD DNA-directed RNA polymerase subunit D
cHOG0338 hla HLAC1819 Hlac_1819 RNA polymerase insert
cHOG0338 hbo HBOR12540 Hbor_12540 DNA-directed RNA polymerase, subunit D( EC:2.7.7.6 )
cHOG0338 hut HUTA2521 Huta_2521 RNA polymerase insert
cHOG0338 hvo HVO_2781 HVO_2781 RNA polymerase Rpb3/Rpb11 dimerisation domain
cHOG0338 nph NP2834A rpoD DNA-directed RNA polymerase subunit D
cHOG0338 hhi 821 rpoD DNA-directed RNA polymerase subunit D
MUSCLE (3.6) multiple sequence alignment


2521|gene|hut       --MAEYDVTFIER--GEREARFLVRGVTPAFANGVRRAMIADVPTFSIDNVRVIENSSVM
10062|gene|hma      -MTQDYEVEFVER--GEREARILVRGITPAFANGIRRAMVADVPTFSIDTVRVIENTSVM
821|gene|hhi        -MTQDYEVEFVER--GEREARILVRGITPAFANGIRRAMVADVPTFSIDTVRVIENTSVM
1136|gene|nrc1      MSSQDFDVEFVDR--DDREARFVVRNITPAFANGIRRAILVDVPTLSIDTVRFVENSSVM
2834|gene|nph       -MSEEYEVTFIDR--DERSARFLVRGVTPAFANGLRRAMIADVPTLSIDTLRVVENSSVM
1819|gene|hla       MTEDDFDVQYVER--DDRSARVLIRGLTPAFANGIRRAMIADVPTFSIDTVRFVENSSVM
2941|gene|hwa       -MTDDFDIEFIERDTDDRSARFLVRGVTPAVANGIRRAMVADIPTFSIEDVRFVENSSVM
12540|gene|hbo      -MAEDFEVEFIER--DDRKARFLVRGMTPAVANGIRRAMIADVPTFSIDTVRFVENSSVM
2781|gene|hvo       -MVNDFQVEFIER--EDRRARFVARGLTPALANGIRRAMVADVPTFSIDTVRFVENTSVM
                        :::: :::*   :* **.: *.:***.***:***::.*:**:**: :*.:**:***

2521|gene|hut       FDEQIGLRLGLVPLTTPVGEFEIGDEVTLALDVQGPDTAYSGDLVGNDEMVEPAEPDVPI
10062|gene|hma      FNEQIGLRLGLVPLTTDLDDFEIGDEVTLSLSVDGPSTAYSSDLVSSDPMVEAADDNIPI
821|gene|hhi        FNEQIGLRLGLVPLTTDLDDFEIGDEVTLSLSVDGPSTAYSSDLVSSDPMVEAADDNIPI
1136|gene|nrc1      FDEQLGLRLGLVPLTTP-EDYAAGEAVTLALDVEGPGTAYSGDLVSNDPEVEAADENIPI
2834|gene|nph       FDEQLALRLGLVPLTTP-DDYEPGETVTLAIDVEGPATAYSGDLVSSDDKVQPADENIPI
1819|gene|hla       FDEMIGLRLGLIPLKTPLDDFEVGDEVTLALDVEGPATAYSGDIESADPLVEVADDNIPI
2941|gene|hwa       FDEMIGLRLGLVPLTTPVDDFDIGDTVTLSLDITGPQTAYSGDIVSSDRLVEPADENIPI
12540|gene|hbo      FDEMIGLRLGLVPLTTPLDDFEQGDTVTLALDVEGPATAYSGDIETSDELVKPAEDNVPI
2781|gene|hvo       FDEMIGLRLGLVPLTTPLDDFEPGDTVTVALEVDGPATAYSGDIESADDMVVPADENIPI
                    *:* :.*****:**.*   ::  *: **:::.: ** ****.*:   *  *  *: ::**

2521|gene|hut       IELKDDQRLELEADAVLDKGREHAKHQGGVAVSYRHLQRVEPQGEREEFADDDAEIVRGV
10062|gene|hma      IDLKEGQRLEVEADAVLDTGREHAKHQGGVAVGYRHLQQVEVVGDLGEFEDDDPNILRGV
821|gene|hhi        IDLKEGQRLEVEADAVLDTGREHAKHQGGVAVGYRHLQQVEVVGDLGEFEDDDPNILRGV
1136|gene|nrc1      IELKDDQRLELEADAVMGHGRDHAKHQGGVAVGYRHLQRVHVVGDSPEYADDDPQMLRGV
2834|gene|nph       IELKDDQQLELEADATLGRGKDHAKHQGGVAVGYRHLQRVEVVGEKGEFEDDEPEILRGV
1819|gene|hla       IELKEGQRLEFEADAVLDTGKEHAKHQGGVSVGYRHLQRVSVEGDLGEFDDDEPRILRGV
2941|gene|hwa       IELKENHRLELEADAVLDTGKSHAKQQGGVAVGYRHLQRIEVIGDADEFADEDPHILRGV
12540|gene|hbo      IELKQGQRLELEADAVLGDGKSHAKHQGGVAVGYRHLHRVEVVGDANEFEEQEPNILRGV
2781|gene|hvo       IELKEGQRLEFEADAVLGHGKDHAKNQGGVAVGYRHLQRVEVVGDAGEFDEQEPNILRGV
                    *:**:.:.**.****.:. *..***:****:*.****:.:   *:  *: :::. ::***

2521|gene|hut       IE------------DDGELVPTEDFDHDLTNRYPDTQVEIEDVTDAFVFHVETDGSFDVD
10062|gene|hma      IEEQAAEHAAGD-ATNGELVATDEFDNDLRNRYPGKDVEVSDVPNAFVFHVETDGSFTTE
821|gene|hhi        IEEQAAEHAAGD-ATNGELVATDEFDNDLRNRYPGKDVEVSDVPNAFVFHVETDGSFTTE
1136|gene|nrc1      IE------------EDDELVPTDDFDNDLTTRYPGKEVEIEDVDGAFVFHVESDGSMPVE
2834|gene|nph       IE------------EDGDLIETGEFDNDLSQRYPGKEVEVEEVPNAFVFDVETDGSMPVE
1819|gene|hla       IE-----------TPDGEIELTDEFDNDLSERFPGKEVSVEDVPGAFVFHIETDGSFSVE
2941|gene|hwa       IEEGAATHAVDETATNGDLIPTTEFDNDLTNRYPGKELTVSDVPNAVVFHVETDGSFSVP
12540|gene|hbo      IEEQAAEHAADESAEDGELVPTSEFDNDLTKRYPGKEVEVHDVPGAFVFHVETDGSFTVP
2781|gene|hvo       IEEAAAEHAEGD-AEDGDLVATETFGNDLTERYPGKEVEVHDVPGAFVFSVETDGSFDVD
                    **             :.::  *  *.:**  *:*..:: : :* .*.** :*:***: . 

2521|gene|hut       TLVKAGVGTLRGRAEELTETIQL
10062|gene|hma      ELVLRAVETLRDRATELKDAVQL
821|gene|hhi        ELVLRAVETLRDRATELKDAVQL
1136|gene|nrc1      ELVLRAVDTLVDRADELEQAVQL
2834|gene|nph       ELVLKAAESIAARADELEEAVAL
1819|gene|hla       ELLLRAIDSIEERADELQTKVAV
2941|gene|hwa       ELVERAARSLGDRAAELETKVAI
12540|gene|hbo      ELVRRAVESISDRAAELEEKVAI
2781|gene|hvo       ELVTRAVASLGDRAAELEEKVAL
                     *:  .  ::  ** **   : :