HOG Organism Gene ID Name Annotation
aHOG3372 hbo HBOR15270 Hbor_15270 hypothetical protein
>15270|hp|hbo
MDRLDTSRVHRLLESPVGGLFETAPLETLQLRRLPRQFAVRRARAAADVSLGAGPAAFLR
EADSPPAPHLHDRIETALAEFAEIRERHEEVSERWEAAFWGDEETTPNERVALERERRRA
DAAHARPSSTFGFLASDHFVPPVAFDVPSPDDARERWAHELAEPERLYGFADSTVTESLP
RVSRSKTVLGPGTVEYRLRFETPSLHVGDTATARVYEPDGAADDIPTLIFFSGLGSYGDR
LGYWPEEEAIGRRLARDGYRAVLPDAPWHGRREPLGQFSGEPYLARMPVSAFELLGAAVQ
ETGVFVDWARTEGAPAVAVGGLSLGGSIAFAVAGRCGEWPESMRPDLVGTVAAPGSLMQT
LSESKLVSLLDLDDALSAAGWTDEDLNEFAPLLDPPAEPDLAPERIFCWYGSHDDVAPTE
TTATLVRQWDVPRRNVRTWDSGHLGTAARLYRGDEFQRTLTAALDRLAVTGRDDDESDAT
AETTT