HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0337COG0026arCOG01597Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)phosphoribosylaminoimidazole carboxylase ATP binding subunit

HOG Organism Gene ID Name Annotation
cHOG0337 nrc1 VNG0632 purK phosphoribosylaminoimidazole carboxylase ATP binding subunit
cHOG0337 hmu HMUK1914 Hmuk_1914 phosphoribosylaminoimidazole carboxylase, ATPase subunit( EC:4.1.1.21 )
cHOG0337 hma RRNAC1431 purK phosphoribosylaminoimidazole carboxylase ATP binding subunit
cHOG0337 hwa HQ1635A purK phosphoribosylaminoimidazole carboxylase carbon dioxide-fixation chain
cHOG0337 hla HLAC0700 Hlac_700 phosphoribosylaminoimidazole carboxylase, ATPase subunit
cHOG0337 hbo HBOR21490 Hbor_21490 phosphoribosylaminoimidazole carboxylase( EC:4.1.1.21 )
cHOG0337 hut HUTA0708 Huta_0708 phosphoribosylaminoimidazole carboxylase, ATPase subunit
cHOG0337 hvo HVO_0976 HVO_0976 purK phosphoribosylaminoimidazole carboxylase ATPase subunit
cHOG0337 nph NP2286A purK phosphoribosylaminoimidazole carboxylase, ATPase subunit
cHOG0337 hhi 2015 purK phosphoribosylaminoimidazole carboxylase ATP binding subunit
MUSCLE (3.6) multiple sequence alignment


632|gene|nrc1       --------------------MLADAASPLGVDVIVLDPTPDCPASQPATDHIRADFDDPD
2286|gene|nph       MRHQTPAATVGVVGGGQLGRMMGEAAGPLGVELVVSDPTPDCPAAPVVRDQIVADFDDYD
708|gene|hut        MTTTLPGPTVGVVGGGQLGRMLGEAAAPLGIEVIVVDPTPDAPASPVVADQIVADFDDPD
11431|gene|hma      MTLTSPGPTVGVVGGGQLGRMLGEAAAPLGLELLVTDPTPDCPAAPVVRDQIVGDFDEAA
2015|gene|hhi       MTLTSPGPTVGVVGGGQLGRMLGEAAAPLGLELLVTDPTPDCPATPVVRDQIVGDFDDEA
700|gene|hla        MTITLPGPTLGVVGGGQLGRMIGEAVAPLGVDIIVLDPTPGCPASPVVSDQIVAGFDDPE
1635|gene|hwa       MSVTVPGPTLGVVGGGQLGRMLAEAAAPLGVEVIVLDPTPDCPAAPVARDHIIGEFDDPD
21490|gene|hbo      MTVTVPGSTLGIVGGGQLGRMLAEAAAPLGVEVVVLDPTPDCPAAPVVRDQIVGDFDDPE
                                        *:.:*..***::::* ****..**:  . *:* . **:  

632|gene|nrc1       GVRELAARADVLTYEIELADPDVLADAAEAHEVAVHPSPETLRTIQDKLVQNRALADAGI
2286|gene|nph       AIHELAERADVLTFEIELADPDEMAAVSEATDTPVHPTPETLRTIQDKLVQNRALDDAGI
708|gene|hut        ALAELADRADYITYEIELAGTGALQTVSQETGTPVHPKPETLSLIEDKLVQKRRLEDAGV
11431|gene|hma      TLRELAERADYLTFEIELADPDVLERVAEETGTPVHPAPETLRTIQDKLVQKRRLSDAGV
2015|gene|hhi       TLRELAERADYLTFEIELADPDVLERVAEETGTPIHPAPETLRTIQDKLVQKRRLSNAGV
700|gene|hla        GIRELASRADALTFEIELADPDLMAEAAAEHDVPVHPDPDTLRTIQDKLVQKEALVDAGI
1635|gene|hwa       AVSDLAARVNAMTFEIELADADLLSDAISTFDVTVNPAPSTLAMIEDKLIQKRTLDDAGI
21490|gene|hbo      AFRELASRADVLTFEIELADSELLDEVSDEYDLAVHPSPDTLSLIEDKLVQKRALDDAGV
                     . :** *.: :*:*****..  :  .      .::* *.**  *:***:*:  * :**:

632|gene|nrc1       PVPAFRAVDDAADLRAAFEELGAPLMLKRRTGGYDGSGNAPVDSVADARAEFGGD-----
2286|gene|nph       PIPAYRQVDSVADLRAAGEALGWPLMLKAREGGYDGRGNRPVEGPEEAPQAFEAV-----
708|gene|hut        PVPEFRGVDSVGELHDALDELGYPAMLKAREGGYDGRGNVPIETPDDVEDAFETIVDAAP
11431|gene|hma      PVPEFRAVDTADDLREACEELGYPAMLKARTGGYDGRGNIRVEGPEDVADAVDEI-----
2015|gene|hhi       PVPEFRAVDTAADLREACEELGYPAMLKARTGGYDGRGNIRVEGPEDVEDAVDDI-----
700|gene|hla        PVPEFVAVATAEGLERVVEEYG-GVMLKAREGGYDGRGNVPVDEPADAADALDEI-----
1635|gene|hwa       PVPSFRPVDTVSELTTALDIFD-AVMLKARTGGYDGRGNVPVTDPANAADALEAV-----
21490|gene|hbo      PVPPFRRVDDAEDLRAALDEFG-SVMLKARTGGYDGRGNVPVRDESEVEDALDAV-----
                    *:* :  *  .  *  . :  .   *** * ***** **  :    :.   .        

632|gene|nrc1       -------LGGFVAEELVDFERELSVIAARG-DAETATFPVAENLHEAEILRESVVPARTS
2286|gene|nph       -------GGAALAEELIDFERELAVMGVRG-ADETCAYPVTETVHEAEILRELVAPARVD
708|gene|hut        GATLDDPSGAAMVEGFVDFQRELAVMGVRG-DGERDTFPVTETIHREEILRETVSPPRAE
11431|gene|hma      -------AGPAMVEEMVDFERELAVMGCRG-ADERDTFPVTETIHREEILRESVAPARAS
2015|gene|hhi       -------AGPAMVEEMVDFERELAVMGCRG-ADERDTFPVTETIHREEILRESVAPARAS
700|gene|hla        -------GGAAMAEEFLDFEREIAVMGLKGADGETRTYPVTETIHREEILRESVAPARTD
1635|gene|hwa       -------GGSAMAERLIDFTRELSVIAVKG-DETVRTFPPGENIHDEEILRETIVPARTS
21490|gene|hbo      -------GGPAMAEAFVDFARELSVIAVQG-DDEVRTFPVGENIHEAEILRETVVPARTT
                            *  :.* ::** **::*:. .*      ::*  *.:*  ***** : *.*. 

632|gene|nrc1       PAVREDATGVAADVLDALDGRGVFGVELF-AVDGRVLVNEIAPRPHNSGHYTIEGCRTSQ
2286|gene|nph       DAVRERAREVAFDVLEMLDGRGVFGIELFETADGGILVNEIAPRPHNSGHWTIEGAGCSQ
708|gene|hut        PAVRERAREVALDVLDVMEGRGVFGIELFQGPDDGIFLNEIAPRPHNSGHWTIEGALTSQ
11431|gene|hma      KAVRERARDVAHDVLDVMDGRGVFGIELFETTDGEILLNEIAPRPHNSGHWTIEGCHTSQ
2015|gene|hhi       KAVREHARDVAHDVLDVMDGRGVFGIELFETTDGEILLNEIAPRPHNSGHWTIEGCHTSQ
700|gene|hla        DAVVAEAESVARDVLDVLDGRGVFGIELFETRDGEVLVNEIAPRPHNSGHWTIEGARTSQ
1635|gene|hwa       EEVRNRANAVARDVLETLDGRGVFGIELFETEAGDILVNEIAPRPHNSGHWTIEGAHSSQ
21490|gene|hbo      DEVLARADEVARDVLSVLDGRGVFGIELFETQDGDISVNEIAPRPHNSGHWTIEGARTSQ
                      *   *  ** ***. ::******:***    . : :************:****.  **

632|gene|nrc1       FEQCIRAVLGLPLGDTTLREPTVMANLIGDPDVDPHPATIAGVPAAFRDAGVALHWYGKR
2286|gene|nph       FEQHVRAVLGWPLGSAEARSPAVTRNILGDVD-QPEAASLAGTGEVLSTPSASLHWYGKR
708|gene|hut        FEQHLRAVVGWPLGATDRRSPTVTGNILGDVD-DRQEATLRNLESVLEADGASMHYYGKE
11431|gene|hma      FEQHLRAVTGQPLGSTDQRFPTVSTNILGDVS-ERQPAELRGEDSVLGTPRAHLHWYGKR
2015|gene|hhi       FEQHLRAVTGQPLGSTDQRFPTVSTNILGDVS-ERQPAALRGEDGILETPRAHLHWYGKR
700|gene|hla        FENHVRAVLGWPLGSTDLVAPAVTANVLGDVE-ETQPAALSGVEEVLAAPEADVHWYGKD
1635|gene|hwa       FEQHIRAVLGWPLGSTARRSPTVMTNILGTVD-NSRPAALTGIEPALTDEHISLHWYGKD
21490|gene|hbo      FEQHVRAVLGWPLGSTARRSPTVMANVLGTVD-ESRPATLGHVESVLAAEGASLHWYGKD
                    **: :*** * *** :    *:*  *::*  . :   * :      :      :*:*** 

632|gene|nrc1       QLRPHRKMAHVTVSGG----------------DDRLARARAARDAVSFTDTHHS--
2286|gene|nph       EVRPLRKMGHVTATDA------------DANRGDLLQTARELDDALTFET------
708|gene|hut        EVYRLRKMGHVTAVGD-----------DNADPGELLERTRDVRDELTFQPS-----
11431|gene|hma      EVYGLRKMGHVTLTDD--------------DRDGLLADARDLRDGLTFE-------
2015|gene|hhi       EVYDLRKMGHVTLTAD--------------DRDGLLADARDLRDGLTFE-------
700|gene|hla        DVRPLRKMGHLTATDRD----------ANADRDALLSRSRDLRDGLTFRNA-----
1635|gene|hwa       EVRPLRKMGHLTLSDDTISITDPSTDPDSLTIQSLIERARQCREAVAFIQTPPESS
21490|gene|hbo      EARPLRKMGHLTVIGD-----------DGADIDNMLTRARDLRDGLTFE-------
                    :    ***.*:*                       :  :*   : ::*