HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0336COG0327KOG4131arCOG04454Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0336 nrc1 VNG1766 vng1766 no entry
cHOG0336 hmu HMUK1695 Hmuk_1695 protein of unknown function DUF34
cHOG0336 hma RRNAC1923 nif3 NGG1p interacting factor 3
cHOG0336 hwa HQ2853A nif3 hypothetical protein
cHOG0336 hla HLAC2161 Hlac_2161 protein of unknown function DUF34
cHOG0336 hbo HBOR07120 Hbor_07120 conserved hypothetical protein TIGR00486
cHOG0336 hut HUTA2576 Huta_2576 protein of unknown function DUF34
cHOG0336 hvo HVO_2298 HVO_2298 conserved hypothetical protein TIGR00486
cHOG0336 nph NP4756A hypothetical protein
cHOG0336 hhi 2433 nif3 NGG1p interacting factor 3
MUSCLE (3.6) multiple sequence alignment


2853|hp|hwa         --MEEQTFITRLDDRLDTAAYADVDASMNGLQVGTTNGHINTVAVAVDAAMATIDIAIER
1766|chp|nrc1       --MDVSDVTSRYNDRLRVTDYA--DAATNGLQVGPGDRSVERIAFAVDAAAATISDAVEW
4756|hp|nph         --MQLETLCSRLDDRLNHDDYADVDASANGLQVGDDDRTVERVAVAVDGVEATVDAAAEA
2161|gene|hla       --MERSEYVRRLDDRLDTAAYADVDASANGLQVGSDRGEIERVAFAVDAADATIEAAADA
7120|chp|hbo        MTMDRADVIARYDEKLATDAYADVDASANGLQVGSESGTVEHVAFAVDAAEATIEAAVEA
2576|hp|hut         --MDCQELCSRFDDRLDVAAYAGIDASENGLQVGPEERDVERVAFAVDAAVETIEGAAEA
11923|gene|hma      --MNAGDIAARLDDRLDIEAYADIDASPNGLQVGPASQPVEHVAFAVDAAVETIDRADEV
2433|gene|hhi       --MNAGDIATRLDDRLDIEAYADIDASPNGLQVGPASQPVEHVAFAVDAAVETIDRAADA
                      *:      * ::.*    **  **: ******     :: :*.***..  *:. * : 

2853|hp|hwa         DVDLLLTHHGLSWGGIDRVTGREYAQIESLMSADIDLYVSHLPLDGHCQLGNAAGLADYI
1766|chp|nrc1       GADLLVVHHGVAWGGLDAVTGREYDRIAALVDGECALYAAHLPLDGHPELGNAAHVADVL
4756|hp|nph         GADLLVVHHGFVWGGLDRVTGREYDRIAACIENDVPLYVSHLPLDGHPELGNAAGLAEFL
2161|gene|hla       DADVLVVHHGISWGGIDRVTDRTYDRVAALADHDLALYVSHLPLDGHPDLGNAAGVAAEL
7120|chp|hbo        GADLLVTHHGLIWGGLDRVTGQEYDRIAPLVENDIGLYVSHLPLDGHQSLGNAAGVADQL
2576|hp|hut         GADLLVVHHGLLWGGDGRVTDLRYRRIERLLDADMALYAVHLPLDGHQDLGNAAGLADVL
11923|gene|hma      GADLLVTHHGIVWGGMERVTGTNYRRVAPLIDNDLALYVAHLPLDGHQSLGNAAGVADLL
2433|gene|hhi       GADLLVTHHGIVWGGMERVTETNYRRVAPLIDNDLALYVAHLPLDGHQSLGNAAGVADLL
                    ..*:*:.***. ***   **   * .:    . :  **. ******* .***** :*  :

2853|hp|hwa         DLNPDSRTAFGELGSVTIGCRGYLDDSVATETIQSRLET-L------HTDDQSVQVLPFG
1766|chp|nrc1       GL--TQRSPFGDHSGEQIGLQGQLPDPTSAPALSKSLAAAL------PTGDQPVQVLDVG
4756|hp|nph         DC--TVTEPFGDYGGVTIGQQAQAETPYTVATLRERLGD-L------DTGGQPVQVLDFG
2161|gene|hla       GL--DDREPFGDIGPVTIGTIGEADAPRSAASLRETLDG-FEGQPDGEDEESPTQVIDFG
7120|chp|hbo        EL--EAREPFGEMGPVHIGQRGQASQPYSVEKLREALDE-F------DNGGTPTQVLDFG
2576|hp|hut         DL--GNRAPFGEIDGEYIGQRGRAREPFTVGELRELLSSEL------DTGGESVQVLDFG
11923|gene|hma      DL--NNRAPFGAMGGEYIGQRGTLSEPQTVSELAGSLEG-L------DTGGQPVQVLDFG
2433|gene|hhi       DL--DNRAPFGSMGGEHIGQRGSLQEPQTVSELAETLEGNL------DTGGQPIQVLDFG
                            .**  .   **  .    . :.  :   *   :           . **: .*

2853|hp|hwa         PDSIESIAIVTGSGADWLDEAAATDVDAFITGEGKQKIYHEARELGVTVFLAGHYATETF
1766|chp|nrc1       PAELTDVAVVTGSGADWLREAEANGVDALVTGEGKGKLYHEAREAGVSVFLAGHYATETG
4756|hp|nph         PETIEDIAIVTGSGTDWIREAEAAGVDALVTGEGKQKAYHEAREAGISVFLAGHYATETF
2161|gene|hla       PDEIQRIAVVTGSGTDWLDEAVDAGADALVTGEGKGQVYHDAREAGLTVFLAGHYATETF
7120|chp|hbo        PDEISEIAIVTGSGVDWLSEAEAVGADALVTGEGKQQVYHEAREAGLNVFLAGHYATETF
2576|hp|hut         PDEIRDVAVVTGSGTDWIDEAAAKDVDALVTGEGKQQVYHRAREHGIHVFLAGHYATETF
11923|gene|hma      PSTVEDVAIVTGSGVDWLQEAVEADADVLITGEGKQQAFHEAREQGMHVVLAGHYATETF
2433|gene|hhi       PSTVEDVAIVTGSGVDWLQEAVETDADVLITGEGKQQAFHEAREQGLHVILAGHYATETF
                    *  :  :*:*****.**: **   ..*.::***** : :* *** *: *.********* 

2853|hp|hwa         GVRHVAEIIESWGVETTFINHPTGL
1766|chp|nrc1       GVRALEAVADDWGVETRFISHPTGL
4756|hp|nph         GVRRIAEPIEEWGLETTFLDHPTGL
2161|gene|hla       GVRSLQALTEEWGLETTYVSHPTGL
7120|chp|hbo        GVRNLAALAQEWGLETTYLDFPTGL
2576|hp|hut         GVRALAGLAEEWDLETTFVEHPTSL
11923|gene|hma      GVQSLQTVVEDLGLETTYIDCPTGL
2433|gene|hhi       GVQSLQTVVEDWGLETTYIDCPTGL
                    **. :    :. .:** ::. **.*